Basic Vector Information
- Vector Name:
- pFA-3xFLAG-MNase-SAT1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4889 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Tebbji F, Khemiri I, Sellam A.
pFA-3xFLAG-MNase-SAT1 vector Map
pFA-3xFLAG-MNase-SAT1 vector Sequence
LOCUS 62056_10510 4889 bp DNA circular SYN 30-SEP-2020 DEFINITION Cloning vector pFA-3xFLAG-MNase-SAT1, complete sequence. ACCESSION MT223485 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4889) AUTHORS Tebbji F, Khemiri I, Sellam A. TITLE High resolution genome-wide occupancy in Candida spp. using ChEC-seq JOURNAL bioRxiv (2020) In press REFERENCE 2 (bases 1 to 4889) AUTHORS Sellam A, Tebbji F, Khemiri I. TITLE Direct Submission JOURNAL REFERENCE 3 (bases 1 to 4889) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "bioRxiv (2020) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (19-MAR-2020) Microbiology, Infectious Disease " COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..4889 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 63..128 /label=3xFLAG /note="three tandem FLAG(R) epitope tags, followed by an enterokinase cleavage site" CDS 135..581 /label=MNase /note="micrococcal nuclease from Staphylococcus aureus" CDS join(1101..1110,1765..2327) /codon_start=1 /transl_table=11 /product="Sat1" /label=Sat1 /note="streptomycin acetyltransferase" /protein_id="QOE54956.1" /translation="MDGEEVAALVIDNGSHMKISVIPEQVAETLDAENHFIVREVFDVH LSDQGFELSTRSVSPYRKDYISDDDSDEDSACYGAFIDQELVGKIELNSTWNDLASIEH IVVSHTHRGKGVAHSLIEFAKKWALSRQLLGIRLETQTNNVPACNLYAKCGFTLGGIDL FTYKTRPQVSNETAMYWYWFSGAQDDA" promoter complement(2527..2545) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" rep_origin complement(2803..3391) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3565..4422) /label=AmpR /note="beta-lactamase" promoter complement(4423..4527) /label=AmpR promoter promoter 4873..4889 /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase"
This page is informational only.