Basic Vector Information
- Vector Name:
- pLL1228
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8469 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Holwerda EK, Zhou J, Hon S, Stevenson D
pLL1228 vector Map
pLL1228 vector Sequence
LOCUS V015730 8469 bp DNA circular SYN 05-OCT-2020 DEFINITION Exported. ACCESSION V015730 VERSION V015730 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 8469) AUTHORS Holwerda EK, Zhou J, Hon S, Stevenson D, Amador-Noguez D, Lynd LR, van Dijken JP. TITLE Metabolic fluxes of nitrogen and pyrophosphate in chemostat cultures of Clostridium thermocellum and Thermoanaerobacterium saccharolyticum JOURNAL Unpublished REFERENCE 2 (bases 1 to 8469) AUTHORS Hon S. TITLE Direct Submission JOURNAL Submitted (28-APR-2020) Thayer School of Engineering, Dartmouth College, 14 Engineering Drive, Hanover, NH 03755, USA REFERENCE 3 (bases 1 to 8469) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (28-APR-2020) Thayer School of Engineering, Dartmouth College, 14 Engineering Drive, Hanover, NH 03755, USA" FEATURES Location/Qualifiers source 1..8469 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 28..573 /label="p15A ori" /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." gene complement(840..1418) /gene="tdk" /label="tdk" CDS complement(840..1418) /codon_start=1 /transl_table=11 /gene="tdk" /product="thymidine kinase" /label="tdk" /protein_id="QOE54900.1" /translation="MYGPKDHGYIEVVTGPMFSGKSEELIRRIKRAKIARQKVQVFKPA IDDRYSIDKVVSHNGDNMHAIAIVKASDILAYAEEDTDVFAIDEVQFFDSEIVDIVKEI ADSGKRVICAGLDMDFRGEPFGPTPELMAIAEFVDKLTAICMKCGNPATRTQRLINGKP ANYDDPIIMVGAKESYEARCRKCHEVPRT" regulatory complement(1419..2039) /label="C. thermocellum cbp promoter" /note="C. thermocellum cbp promoter" /regulatory_class="promoter" CDS complement(2118..3119) /label="repB" /note="RepB replication protein" rep_origin complement(3120..3574) /direction=LEFT /label="C. thermocellum origin of replication" /note="C. thermocellum origin of replication" CDS complement(3680..4537) /label="AmpR" /note="beta-lactamase" promoter complement(4538..4642) /label="AmpR promoter" misc_feature 4732..5244 /label="upstream homologous recombination flank" /note="upstream homologous recombination flank" misc_feature 5245..5736 /label="downstream homologous recombination flank" /note="downstream homologous recombination flank" regulatory 5740..6314 /label="C. thermocellum gapdh promoter" /note="C. thermocellum gapdh promoter" /regulatory_class="promoter" CDS 6315..6962 /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" gene 6983..7528 /gene="hpt" /label="hpt" CDS 6983..7528 /codon_start=1 /transl_table=11 /gene="hpt" /product="hypoxanthine phosphoribosyltransferase" /label="hpt" /protein_id="QOE54904.1" /translation="MENLSKDIDEILITEEELKEKIKELGRQITKDYKGKNLMLVGVLK GALMFMADLSRHIDLPLSLDFMAVSSYGSSTHSSGIVKIIKDLDISIEGKDVLIVEDII DSGLTLSYLRETLLGRKPKSLKICTILDKPERREASVKVDYVGFKIPDKFVVGYGLDFD EKYRNLPFIGVLKPEMYS" misc_feature 7713..8226 /note="gene target internal homologous recombination region" terminator 8259..8447 /label="CYC1 terminator" /note="transcription terminator for CYC1"
This page is informational only.