Basic Vector Information
- Vector Name:
- pLM162-mScarlet-i
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5256 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Emrich-Mills TZ, Yates G, Barrett J, Grouneva I
pLM162-mScarlet-i vector Map
pLM162-mScarlet-i vector Sequence
LOCUS 62056_14345 5256 bp DNA circular SYN 28-MAR-2021 DEFINITION Cloning vector pLM162-mScarlet-i, complete sequence. ACCESSION MT737963 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5256) AUTHORS Emrich-Mills TZ, Yates G, Barrett J, Grouneva I, Lau CS, Walker CE, Kwok TK, Davey JW, Johnson MP, Mackinder LCM. TITLE Direct Submission JOURNAL Submitted (08-JUL-2020) Molecular Biology and Biotechnology, University of Sheffield, Western Bank, Sheffield, South Yorkshire S10 2TN, United Kingdom REFERENCE 2 (bases 1 to 5256) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (08-JUL-2020) Molecular Biology and Biotechnology, University of Sheffield, Western Bank, Sheffield, South Yorkshire S10 2TN, United Kingdom" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..5256 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 28..723 /label=mScarlet-I /note="bright monomeric red fluorescent protein evolved from a synthetic template (Bindels et al., 2016)" CDS 775..798 /label=FLAG /note="FLAG(R) epitope tag, followed by an enterokinase cleavage site" CDS join(1541..1627,1773..2684) /codon_start=1 /transl_table=11 /product="APHVII" /label=APHVII /note="hygromycin resistance marker" /protein_id="QTE34487.1" /translation="MTQESLLLLDRIDSDDSYASLRNDQEFWEPLARRALEELGLPVPP VLRVPGESTNPVLVGEPGPVIKLFGEHWCGPESLASESEAYAVLADAPVPVPRLLGRGE LRPGTGAWPWPYLVMSRMTGTTWRSAMDGTTDRNALLALARELGRVLGRLHRVPLTGNT VLTPHSEVFPELLRERRAATVEDHRGWGYLSPRLLDRLEDWLPDVDTLLAGREPRFVHG DLHGTNIFVDLAATEVTGIVDFTDVYAGDSRYSLVQLHLNAFRGDREILAALLDGAQWK RTEDFARELLAFTFLHDFEVFEETPLDLSGFTDPEELAQFLWGPPDTAPGA" rep_origin 2993..3538 /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." CDS complement(3637..4449) /label=KanR /note="aminoglycoside phosphotransferase" CDS 4899..5201 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase"
This page is informational only.