Basic Vector Information
- Vector Name:
- p191-LI-TA
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 4817 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Chiasson D, Gimenez-Oya V, Bircheneder M, Bachmaier S
p191-LI-TA vector Map
p191-LI-TA vector Sequence
LOCUS 62056_1895 4817 bp DNA circular SYN 29-JUL-2019 DEFINITION Cloning vector p191 LI-TA, complete sequence. ACCESSION MK495750 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4817) AUTHORS Chiasson D, Gimenez-Oya V, Bircheneder M, Bachmaier S, Studtrucker T, Ryan J, Sollweck K, Leonhardt H, Boshart M, Dietrich P, Parniske M. TITLE A unified multi-kingdom Golden Gate cloning platform JOURNAL Sci Rep 9 (1), 10131 (2019) PUBMED 31300661 REFERENCE 2 (bases 1 to 4817) AUTHORS Chiasson D. TITLE Direct Submission JOURNAL Submitted (06-FEB-2019) Biology, LMU Munich, Grosshaderner Str. 2-4, Martinsried 82152, Germany REFERENCE 3 (bases 1 to 4817) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Sci Rep"; date: "2019"; volume: "9"; issue: "1"; pages: "10131" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (06-FEB-2019) Biology, LMU Munich, Grosshaderner Str. 2-4, Martinsried 82152, Germany" FEATURES Location/Qualifiers source 1..4817 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 59..183 /label=attR1 /note="recombination site for the Gateway(R) LR reaction" promoter 220..250 /label=lac UV5 promoter /note="E. coli lac promoter with an 'up' mutation" CDS 304..960 /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" CDS 1305..1607 /codon_start=1 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK VPRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI" protein_bind complement(1651..1775) /label=attR2 /note="recombination site for the Gateway(R) LR reaction" terminator 1885..1979 /label=lambda t0 terminator /note="transcription terminator from phage lambda" promoter 2052..2143 /label=AmpR promoter CDS 2144..3001 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" terminator 3008..3047 /label=fd terminator /note="central terminator from bacteriophage fd (Otsuka and Kunisawa, 1982)" oriT 3194..3302 /label=oriT /note="incP origin of transfer" rep_origin 3338..3926 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(4112..4252) /label=bom /note="basis of mobility region from pBR322" CDS complement(4357..4545) /codon_start=1 /label=rop /note="Rop protein, which maintains plasmids at low copy number" /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA DELYRSCLARFGDDGENL" terminator complement(4725..4811) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene"
This page is informational only.