Basic Vector Information
- Vector Name:
- Cam_RbsR_TAN_CelR_KSL
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 5388 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Rondon RE, Groseclose TM, Short AE, Wilson CJ.
Cam_RbsR_TAN_CelR_KSL vector Map
Cam_RbsR_TAN_CelR_KSL vector Sequence
LOCUS 62056_461 5388 bp DNA circular SYN 03-DEC-2019 DEFINITION Cloning vector Cam_RbsR_TAN_CelR_KSL, complete sequence. ACCESSION MN207955 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5388) AUTHORS Rondon RE, Groseclose TM, Short AE, Wilson CJ. TITLE Transcriptional programming using engineered systems of transcription factors and genetic architectures JOURNAL Nat Commun 10 (1), 4784 (2019) PUBMED 31636266 REFERENCE 2 (bases 1 to 5388) AUTHORS Rondon RE, Groseclose T, Short A, Wilson CJ. TITLE Direct Submission JOURNAL Submitted (21-JUL-2019) Chemical and Biomolecular Engineering, Georgia Institute of Technology, 950 Atlantic dr. NW, 5110E, Atlanta, GA 30332, United States REFERENCE 3 (bases 1 to 5388) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat Commun"; date: "2019"; volume: "10"; issue: "1"; pages: "4784" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (21-JUL-2019) Chemical and Biomolecular Engineering, Georgia Institute of Technology, 950 Atlantic dr. NW, 5110E, Atlanta, GA 30332, United States" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..5388 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(139..327) /label=rop /note="Rop protein, which maintains plasmids at low copy number" CDS complement(463..1476) /codon_start=1 /transl_table=11 /product="CelR KSL" /label=CelR KSL /protein_id="QFU95592.1" /translation="MKPVTLYDVAEYAGVSKSTVSLVVNQASHVSAKTREKVEAAIKEL GYVPNRAARTLVTRRTDTVALVVSENNQKLFAEPFYAGIVLGVGVALSERGFQFVLATG RSGIEHERLGGYLAGQHVDGVLLLSLHRDDPLPQMLDEAGVPYVYGGRPLGVPEEQVSY VDIDNIGGGRQATQRLIETGHRRIATIAGPQDMVAGVERLQGYREALLAAGMEYDETLV SYGDFTYDSGVAAMRELLDRAPDVDAVFAASDLMGLAALRVLRASGRRVPEDVAVVGYD DSTVAEHAEPPMTSVNQPTELMGREMARLLVDRITGETTEPVRLVLETHLMVRESG" promoter complement(1477..1554) /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." promoter 2255..2332 /label=lacI promoter CDS 2333..3331 /codon_start=1 /transl_table=11 /product="RbsR TAN" /label=RbsR TAN /protein_id="QFU95593.1" /translation="MKPVTLYDVAEYAGVSTATVSNVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKASHTIGMLITASTNPFYSELVRGVERSCFERGYSLVLCNTEGDEQ RMNRNLETLMQKRVDGLLLLCTETHQPSREIMQRYPTVPTVMMDWAPFDGDSDLIQDNS LLGGDLATQYLIDKGHTRIACITGPLDKTPARLRLEGYRAAMKRAGLNIPDGYEVTGDF EFNGGFDAMRQLLSHPLRPQAVFTGNDAMAVGVYQALYQAELQVPQDIAVIGYDDIELA SFMTPPLTTIHQPKDELGELAIDVLIHRITQPTLQQQRLQLTPILMERGSA" protein_bind 3344..3365 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin 3556..4100 /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." promoter 4626..4728 /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS 4729..5385 /label=CmR /note="chloramphenicol acetyltransferase"
This page is informational only.