pCI-7608NEP-Gluc1 vector (V015687)

LOCUS       62056_6355        4692 bp DNA     circular SYN 28-OCT-2020
DEFINITION  Cloning vector pCI-7608NEP-Gluc1, complete sequence.
ACCESSION   MT966976
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4692)
  AUTHORS   Declercq M, Biquand E, Karim M, Pietrosemoli N, Jacob Y, Demeret C, 
            Barbezange C, van der Werf S.
  TITLE     Influenza A virus co-opts ERI1 exonuclease bound to histone mRNA to 
            promote viral transcription
  JOURNAL   Nucleic Acids Res 48 (18), 10428-10440 (2020)
  PUBMED    32960265
REFERENCE   2  (bases 1 to 4692)
  AUTHORS   Declercq M, Biquand E, Demeret C, Karim M, Pietrosemoli N, Jacob Y, 
            Demeret C, Van der Werf S, Barbezange C.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-SEP-2020) National Influenza Centre, Sciensano, Rue 
            Juliette Wytsman 14, Brussels 1180, Belgium
REFERENCE   3  (bases 1 to 4692)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic 
            Acids Res"; date: "2020"; volume: "48"; issue: "18"; pages: 
            "10428-10440"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (03-SEP-2020) National Influenza Centre, Sciensano, Rue Juliette 
            Wytsman 14, Brussels 1180, Belgium"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..4692
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     enhancer        139..517
                     /label=CMV enhancer
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        518..721
                     /label=CMV promoter
                     /note="human cytomegalovirus (CMV) immediate early
                     promoter"
     intron          857..989
                     /label=chimeric intron
                     /note="chimera between introns from human beta-globin and 
                     immunoglobulin heavy chain genes"
     misc_feature    1012..1027
                     /label=sequencing primer
                     /note="sequencing primer"
     promoter        1034..1052
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     CDS             1067..1747
                     /codon_start=1
                     /transl_table=11
                     /product="7608NEP-Gluc1"
                     /label=7608NEP-Gluc1
                     /note="Influenza virus A/Bretagne/7608/2009 NEP protein
                     fused to Gaussia luciferase domain 1"
                     /protein_id="QOQ50707.1"
                     /translation="MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSL
                     GETVMRMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFMQALQ
                     LLLEVEQEIRAFSFQLIAAAGGGGSGGGGSKPTENNEDFNIVAVASNFATTDLDADRGK
                     LPGKKLPLEVLKEMEANARKAGCTRGCLICLSHIKCTPKMKKFIPGRCHTYEGDKESAQ
                     GGIG"
     misc_feature    1067..1429
                     /label=Influenza virus A/Bretagne/7608/2009 NEP protein
                     /note="Influenza virus A/Bretagne/7608/2009 NEP protein"
     misc_feature    1430..1468
                     /label=linker
                     /note="linker"
     misc_feature    1469..1750
                     /label=Gaussia luciferase domain 1
                     /note="Gaussia luciferase domain 1"
     polyA_signal    complement(1806..1927)
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     rep_origin      2108..2563
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        2895..2999
                     /label=AmpR promoter
     CDS             3000..3857
                     /label=AmpR
                     /note="beta-lactamase"
     rep_origin      4031..4619
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"