Basic Vector Information
- Vector Name:
- AGG1521-pCHIKVRep1
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5623 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Tng PYL., Carabajal Paladino L, Verkuijl SAN., Purcell J
- Promoter:
- lac
AGG1521-pCHIKVRep1 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
AGG1521-pCHIKVRep1 vector Sequence
LOCUS 62056_316 5623 bp DNA circular SYN 12-AUG-2020 DEFINITION Cloning vector AGG1521:pCHIKVRep1, complete sequence. ACCESSION MT119957 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5623) AUTHORS Tng PYL., Carabajal Paladino L, Verkuijl SAN., Purcell J, Merits A, Leftwich PT, Fragkoudis R, Noad R, Alphey L. TITLE Cas13b-dependent and Cas13b-independent RNA knockdown of viral sequences in mosquito cells following guide RNA expression JOURNAL Commun Biol 3 (1), 413 (2020) PUBMED 32737398 REFERENCE 2 (bases 1 to 5623) AUTHORS Tng PYL., Carabajal Paladino L, Verkuijl S, Purcell J, Merits A, Leftwich PT, Fragkoudis R, Noad R, Alphey L. TITLE Direct Submission JOURNAL Submitted (26-FEB-2020) Arthropod Genetics Group, The Pirbright Institute, Ash Road, Pirbright, Woking, Surrey GU24 0NF, UK REFERENCE 3 (bases 1 to 5623) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Commun Biol"; date: "2020"; volume: "3"; issue: "1"; pages: "413" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (26-FEB-2020) Arthropod Genetics Group, The Pirbright Institute, Ash Road, Pirbright, Woking, Surrey GU24 0NF, UK" FEATURES Location/Qualifiers source 1..5623 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(227..1033) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" primer_bind 1525..1541 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS 2526..3242 /codon_start=1 /label=EGFP /note="enhanced GFP" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL EFVTAAGITLGMDELYK" CDS 3424..3936 /codon_start=1 /label=Nluc /note="NanoLuc(R) luciferase" /translation="MVFTLEDFVGDWRQTAGYNLDQVLEQGGVSSLFQNLGVSVTPIQR IVLSGENGLKIDIHVIIPYEGLSGDQMGQIEKIFKVVYPVDDHHFKVILHYGTLVIDGV TPNMIDYFGRPYEGIAVFDGKKITVTGTLWNGNKIIDERLINPDGSLLFRVTINGVTGW RLCERILA" polyA_signal 4533..4654 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" primer_bind complement(4679..4695) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(4703..4719) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(4727..4757) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(4772..4793) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(join(5081..5623,1..46)) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.