Basic Vector Information
- Vector Name:
- L4440-2XproD-gtwy
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4705 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Velasco L.
- Promoter:
- lac UV5
L4440-2XproD-gtwy vector Map
L4440-2XproD-gtwy vector Sequence
LOCUS 62056_1390 4705 bp DNA circular SYN 12-MAY-2021
DEFINITION Cloning vector L4440-2XproD-gtwy, complete genome.
ACCESSION MT333852
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4705)
AUTHORS Velasco L.
TITLE An efficient dsRNA constitutive expression system for bacteria
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 4705)
AUTHORS Velasco L.
TITLE Direct Submission
JOURNAL Submitted (13-APR-2020) Plant Protection, Instituto Andaluz de
Investigacion y Formacion Agraria y Pesquera (IFAPA), Cortijo de la
Cruz s/n, Churriana, Malaga 29140, Spain
REFERENCE 3 (bases 1 to 4705)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(13-APR-2020) Plant Protection, Instituto Andaluz de Investigacion y
Formacion Agraria y Pesquera (IFAPA), Cortijo de la Cruz s/n,
Churriana, Malaga 29140, Spain"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..4705
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 587..605
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
regulatory 616..775
/label=proD
/note="proD"
/regulatory_class="promoter"
protein_bind 783..907
/label=attR1
/note="recombination site for the Gateway(R) LR reaction"
promoter 932..962
/label=lac UV5 promoter
/note="E. coli lac promoter with an 'up' mutation"
gene 1016..1696
/gene="cat"
/label=cat
CDS 1016..1696
/codon_start=1
/transl_table=11
/gene="cat"
/product="chloramphenicol acetyltransferase"
/label=cat
/note="CAT marker"
/protein_id="QUV72827.1"
/translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNEYNSTAMSGRAGRKRV
DPAY"
CDS 2015..2317
/label=ccdB
/note="CcdB, a bacterial toxin that poisons DNA gyrase"
protein_bind complement(2361..2485)
/label=attR2
/note="recombination site for the Gateway(R) LR reaction"
primer_bind complement(2500..2516)
/label=KS primer
/note="common sequencing primer, one of multiple similar
variants"
promoter complement(2706..2724)
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
primer_bind complement(2734..2750)
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
rep_origin 2892..3347
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
promoter 3373..3477
/label=AmpR promoter
CDS 3478..4335
/label=AmpR
/note="beta-lactamase"
rep_origin 4509..4705
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
This page is informational only.