Basic Vector Information
- Vector Name:
- L4440-2XproD-gtwy
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4705 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Velasco L.
- Promoter:
- lac UV5
L4440-2XproD-gtwy vector Map
L4440-2XproD-gtwy vector Sequence
LOCUS 62056_1390 4705 bp DNA circular SYN 12-MAY-2021 DEFINITION Cloning vector L4440-2XproD-gtwy, complete genome. ACCESSION MT333852 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4705) AUTHORS Velasco L. TITLE An efficient dsRNA constitutive expression system for bacteria JOURNAL Unpublished REFERENCE 2 (bases 1 to 4705) AUTHORS Velasco L. TITLE Direct Submission JOURNAL Submitted (13-APR-2020) Plant Protection, Instituto Andaluz de Investigacion y Formacion Agraria y Pesquera (IFAPA), Cortijo de la Cruz s/n, Churriana, Malaga 29140, Spain REFERENCE 3 (bases 1 to 4705) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (13-APR-2020) Plant Protection, Instituto Andaluz de Investigacion y Formacion Agraria y Pesquera (IFAPA), Cortijo de la Cruz s/n, Churriana, Malaga 29140, Spain" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..4705 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 587..605 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" regulatory 616..775 /label=proD /note="proD" /regulatory_class="promoter" protein_bind 783..907 /label=attR1 /note="recombination site for the Gateway(R) LR reaction" promoter 932..962 /label=lac UV5 promoter /note="E. coli lac promoter with an 'up' mutation" gene 1016..1696 /gene="cat" /label=cat CDS 1016..1696 /codon_start=1 /transl_table=11 /gene="cat" /product="chloramphenicol acetyltransferase" /label=cat /note="CAT marker" /protein_id="QUV72827.1" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNEYNSTAMSGRAGRKRV DPAY" CDS 2015..2317 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" protein_bind complement(2361..2485) /label=attR2 /note="recombination site for the Gateway(R) LR reaction" primer_bind complement(2500..2516) /label=KS primer /note="common sequencing primer, one of multiple similar variants" promoter complement(2706..2724) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(2734..2750) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" rep_origin 2892..3347 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 3373..3477 /label=AmpR promoter CDS 3478..4335 /label=AmpR /note="beta-lactamase" rep_origin 4509..4705 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.