Basic Vector Information
- Vector Name:
- pSC101-mKate2-AattB-AattP-BFP-RBS8-GP44-AAV
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5348 bp
- Type:
- Cloning vector
- Replication origin:
- pSC101 ori
- Source/Author:
- Guo L.
- Promoter:
- J23119
pSC101-mKate2-AattB-AattP-BFP-RBS8-GP44-AAV vector Vector Map
pSC101-mKate2-AattB-AattP-BFP-RBS8-GP44-AAV vector Sequence
LOCUS 62056_19365 5348 bp DNA circular SYN 16-MAY-2020 DEFINITION Cloning vector pSC101-mKate2-AattB-AattP-BFP-RBS8-GP44-AAV, complete sequence. ACCESSION MN623113 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5348) AUTHORS Guo L. TITLE Direct Submission JOURNAL Submitted (28-OCT-2019) Jiangnan University, State Key Laboratory of Food Science and Technology, 1800 Lihu Avenue, Wuxi, Jiangsu 214122, China REFERENCE 2 (bases 1 to 5348) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (28-OCT-2019) Jiangnan University, State Key Laboratory of Food Science and Technology, 1800 Lihu Avenue, Wuxi, Jiangsu 214122, China" FEATURES Location/Qualifiers source 1..5348 /mol_type="other DNA" /organism="synthetic DNA construct" terminator complement(100..129) /label=T3Te terminator /note="phage T3 early transcription terminator" CDS complement(185..880) /label=mKate2 /note="monomeric far-red fluorescent protein (Shcherbo et al., 2009)" promoter complement(967..1001) /label=J23119 promoter /note="bacterial promoter (Registry of Standard Biological Parts BBa_J23119)" terminator 1018..1089 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" CDS 1183..1881 /label=TagBFP /note="monomeric blue fluorescent protein" gene 1908..2123 /gene="gp44" /label=gp44 CDS 1908..2123 /codon_start=1 /transl_table=11 /gene="gp44" /product="recombination directionality factor" /label=gp44 /note="Gp44" /protein_id="QJR97795.1" /translation="MSEVLVSASYEGYESNSINFTEINNIVKERFKKIDEVERKKRAET FNKKYEVTKELVNGHLREIIIPRRLIK" terminator 2207..2238 /label=tonB terminator /note="bidirectional E. coli tonB-P14 transcription terminator" terminator 2363..2457 /label=lambda t0 terminator /note="transcription terminator from phage lambda" rep_origin 2949..3171 /label=pSC101 ori /note="low-copy replication origin that requires the Rep101 protein" CDS 3219..4166 /label=Rep101 /note="RepA protein needed for replication with the pSC101 origin" CDS 4458..5315 /label=AmpR /note="beta-lactamase" terminator 5329..5348 /label=his operon terminator /note="This putative transcriptin terminator from the E. coli his operon has a 2-bp deletion introduced during synthesis. Its efficiency has not been determined."
This page is informational only.