Basic Vector Information
- Vector Name:
- pVEcLa4
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6217 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Vezina B, Moore RJ.
- Promoter:
- SP6
pVEcLa4 vector Vector Map
pVEcLa4 vector Sequence
LOCUS V015639 6217 bp DNA circular SYN 31-JUL-2019 DEFINITION Exported. ACCESSION V015639 VERSION V015639 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 6217) AUTHORS Vezina B, Moore RJ. TITLE Bioinformatic analysis and development of molecular tools for broiler chickens live Lactobacillis vaccine vector candidate JOURNAL Unpublished REFERENCE 2 (bases 1 to 6217) AUTHORS Vezina B, Moore RJ. TITLE Direct Submission JOURNAL Submitted (08-JAN-2019) Microbiology, Monash University, Monash University, Clayton Campus, Wellington Rd, Clayton, VIC 3800, Australia REFERENCE 3 (bases 1 to 6217) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (08-JAN-2019) Microbiology, Monash University, Monash University, Clayton Campus, Wellington Rd, Clayton, VIC 3800, Australia" FEATURES Location/Qualifiers source 1..6217 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 101..814 /codon_start=1 /transl_table=11 /product="Rep pLa3_4" /label="Rep pLa3_4" /note="Rep protein" /protein_id="QDQ71306.1" /translation="MPEKKKDNRARTWTFIVYPESVPNNWRELLDSYHIPWVESPLHDK DVNPDGTIKKPHWHVILMFDGKKSYEQIKEITDSLNAPVPQKTANPKGLVRYLIHMDNP EKYQYKKEDIVCHSGAEVEQYFQLSSASRLQILKEMIIFIKDSRFENYLDFLAYCIENG EDEWLDIAVNHNTLALSKVIDSVYQKNHPKTPQTDYKQTVVAKAKEMARQGTSQRVIAD TLGISPATVNRYLKK" CDS 1587..1901 /codon_start=1 /transl_table=11 /product="ORF-2" /label="ORF-2" /protein_id="QDQ71307.1" /translation="MLFLTNFRQKARLNSRYPTSCVLWRGPTWFLLTSPWSDSKGKVRR SFFGSFFVASNENKNSFCKNDLGFLNFKNYFCENKNKKARSKNTVRFFIFDFGFEENIF " CDS complement(1957..2115) /codon_start=1 /transl_table=11 /product="ORF-3" /label="ORF-3" /protein_id="QDQ71308.1" /translation="MIYFLWLSNQSLSKNKKIPTKSGAVTAISKEFIPSPPFQLAKGHS NLSIISR" CDS 2361..2981 /gene="catP" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Clostridium perfringens. Accession#: P26826" promoter complement(3342..3360) /label="SP6 promoter" /note="promoter for bacteriophage SP6 RNA polymerase" primer_bind complement(3378..3394) /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" protein_bind complement(3402..3418) /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(3426..3456) /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind complement(3471..3492) /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(3780..4368) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(4542..5399) /label="AmpR" /note="beta-lactamase" promoter complement(5400..5504) /label="AmpR promoter" rep_origin complement(5582..6037) /direction=LEFT /label="f1 ori" /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 6178..6194 /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" promoter 6201..6217 /label="T7 promoter" /note="promoter for bacteriophage T7 RNA polymerase"
This page is informational only.