Basic Vector Information
- Vector Name:
- p2BBAD-phaB2-phaC2
- Antibiotic Resistance:
- Kanamycin
- Length:
- 8946 bp
- Type:
- Expression vector
- Replication origin:
- pBBR1 oriV
- Source/Author:
- Tang R, Peng X, Weng C, Han Y.
- Promoter:
- araBAD
p2BBAD-phaB2-phaC2 vector Vector Map
p2BBAD-phaB2-phaC2 vector Sequence
LOCUS 62056_1930 8946 bp DNA circular SYN 17-NOV-2021 DEFINITION Expression vector p2BBAD-phaB2-phaC2, complete sequence. ACCESSION OL331254 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8946) AUTHORS Tang R, Peng X, Weng C, Han Y. TITLE The over-expression of phasin and regulator genes promoting the synthesis of polyhydroxybutyrate in Cupriavidus necator H16 under non-stress conditions JOURNAL Appl Environ Microbiol, AEM0145821 (2021) In press PUBMED 34731058 REFERENCE 2 (bases 1 to 8946) AUTHORS Tang R, Peng X, Weng C, Han Y. TITLE Direct Submission JOURNAL Submitted (31-OCT-2021) National Key Laboratory of Biochemical Engineering, Institute of Process Engineering, Chinese Academy of Sciences, 1 North 2nd Street, Zhongguancun PR, Beijing, Beijing 100190, China REFERENCE 3 (bases 1 to 8946) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl Environ Microbiol, AEM0145821 (2021) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (31-OCT-2021) National Key Laboratory of Biochemical Engineering, Institute of Process Engineering, Chinese Academy of Sciences, 1 North 2nd Street, Zhongguancun PR, Beijing, Beijing 100190, China" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..8946 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 1023..1792 /label=pBBR1 oriV /note="replication origin of the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica; requires the pBBR1 Rep protein for replication" CDS 1793..2452 /label=pBBR1 Rep /note="replication protein for the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica" primer_bind 3162..3178 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 3188..3206 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" CDS complement(3248..4123) /label=araC /note="L-arabinose regulatory protein" promoter 4150..4434 /label=araBAD promoter /note="promoter of the L-arabinose operon of E. coli; the araC regulatory gene is transcribed in the opposite direction (Guzman et al., 1995)" regulatory 4492..4507 /regulatory_class="ribosome_binding_site" gene 4514..5260 /gene="phaB2" /label=phaB2 CDS 4514..5260 /codon_start=1 /transl_table=11 /gene="phaB2" /product="PhaB2" /EC_number="1.1.1.36" /label=phaB2 /note="acetoacetyl-CoA reductase; derived from Cupriavidus necator H16" /protein_id="UEP67409.1" /translation="MAGQRIALVTGGMGGLGEAIAVRLLADGARVVVTHSVHNDHVAQW LGTQRSAGREFTAFPVDVTDFASCQRCVSQVRSELGDVDILINNAGVTRDRTLRKMDKA DWDFVLRTDLDSLFHMTRPLVEPMLARGWGRIVNISSVNASRGAFGQTNYAAAKAGVHG FTKALALELARKGITVNTVSPGYLDTHMVTDMPAEILERDVLPTIPVGRLGKPAEVAAL ISYLCSDDGAFVTGANFAINGGQHLQ" gene 5261..7036 /gene="phaC2" /label=phaC2 CDS 5261..7036 /codon_start=1 /transl_table=11 /gene="phaC2" /product="PhaC2" /label=phaC2 /note="poly(3-hydroxybutyrate) polymerase; derived from Cupriavidus necator H16" /protein_id="UEP67410.1" /translation="MRIDDRTSPPSLSAMPECAPQAAIPAQVWMDKQIRAGLARATGGL SVISASLAGLDWALQLGISPAKIVQAWQVWLQHSIEDWPRLLPTAAEPPSVDLSDQRFA DAGWQDWPYRCWRDAFMRNEAFWESLTQDIDGLSRHHQHIVAFCARQWLDLLAPGNVWW MNPTIARTASSTFGANFLQGAHHWLQDASELLSKVPGLPAGRPALEFLPGRDVARTPGK VVFRNALIELIEYAPALGANTVWREPVLIVPSWIMRYYILDLKPEDSLVRYLVESGHTV FMISWKNPDASARDFGLDTYLEAGLLTALNTVHARCDGAHVHAAGYCLGGTLLATGAAM LARDAAGGPLASMTLFASETDFHDPGELGLFIDKSSLATLDALMWSQGYLDGPQMKSAF QMLNAQDLIWSRVMSEYLLGQRLRANDLVSWNRDTTRLPYRLHSECLHKLFLGNELATG KLCVGGQPVALSDLDLPLFVVGTEHDHVSPWRSVYKLHLLTKAELTFLLTSGGHNAGIV SEPGHPGRRYHVHTRLPAAPYLSPEQFLNVAVYRDGSWWPAWHDWLVAHSTARCTRQAP GQGLADAPGTYVLEP" terminator 7047..7093 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" promoter complement(7137..7155) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(7176..7192) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(7200..7216) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(7224..7254) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(7269..7290) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." CDS complement(7698..8489) /label=NeoR/KanR /note="aminoglycoside phosphotransferase"
This page is informational only.