pLPV2Z vector (V015605)

Download GeneBank File(.gb)

LOCUS       62056_14365        7545 bp DNA     circular SYN 20-JUL-2019
DEFINITION  Shuttle vector pLPV2Z, complete sequence.
ACCESSION   MK681507
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7545)
  AUTHORS   Visca P.
  TITLE     New shuttle vectors for real-time gene expression analysis in 
            multidrug-resistant Acinetobacter species: in vitro and in vivo 
            applications
  JOURNAL   Appl. Environ. Microbiol. (2019) In press
REFERENCE   2  (bases 1 to 7545)
  AUTHORS   Lucidi M, Prencipe E, Visca P.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-MAR-2019) Department of Science, Roma Tre University, 
            Viale Marconi 446, Rome, Roma 00146, Italia
REFERENCE   3  (bases 1 to 7545)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Appl. 
            Environ. Microbiol. (2019) In press"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (23-MAR-2019) Department of Science, Roma Tre University, Viale 
            Marconi 446, Rome, Roma 00146, Italia"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7545
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      194..782
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     promoter        974..992
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     primer_bind     1022..1038
                     /label=KS primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     primer_bind     complement(1072..1088)
                     /label=SK primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     misc_feature    1097..1107
                     /label=stop codons in all the three reading frames
                     /note="stop codons in all the three reading frames"
     regulatory      1107..1117
                     /label=optimized RBS
                     /note="optimized RBS"
                     /regulatory_class="ribosome_binding_site"
     CDS             1124..4195
                     /label=lacZ
                     /note="beta-galactosidase"
     regulatory      4306..4334
                     /label=ble gene predicted promoter
                     /note="ble gene predicted promoter"
                     /regulatory_class="promoter"
     CDS             4379..4750
                     /label=BleoR
                     /note="antibiotic-binding protein"
     promoter        4927..5031
                     /label=AmpR promoter
     promoter        5049..5077
                     /label=Pc promoter
                     /note="class 1 integron promoter"
     CDS             5266..5796
                     /label=GmR
                     /note="gentamycin acetyltransferase"
     regulatory      5959..5986
                     /label=putative antitoxin-toxin module-predicted promoter
                     /note="putative antitoxin-toxin module-predicted promoter"
                     /regulatory_class="promoter"
     CDS             6020..6313
                     /codon_start=1
                     /transl_table=11
                     /product="putative PaaA2-like antitoxin"
                     /label=putative PaaA2-like antitoxin
                     /note="putative component of an antitoxin-toxin system
                     involved in plasmid stability and maintenance"
                     /protein_id="QDL88245.1"
                     /translation="MTEATFTFRVDHDLKQEFSSLAKTVDRSGAQLIRDFMRDFVKKQQ
                     EAADYDKWFKQQVQIGLNEANAGKLIPHEDVKAEFAARRAATLAKLAAKNED"
     CDS             6303..6572
                     /codon_start=1
                     /transl_table=11
                     /product="putative ParE2-like toxin"
                     /label=putative ParE2-like toxin
                     /note="putative component of an antitoxin-toxin system
                     involved in plasmid stability and maintenance"
                     /protein_id="QDL88246.1"
                     /translation="MKIEWTETARQDRRNIYDYLEERNPIAAIEIDDLIEEKTDLLVDN
                     RLMGRTGRQKDTRELVIHPHYVVVYDITDIIRILRVLHTSQEWS"
     regulatory      6573..7544
                     /note="minimal origin of replication for Acinetobacter
                     spp."
                     /regulatory_class="replication_regulatory_region"