Basic Vector Information
- Vector Name:
- PCM28
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5594 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- DSouza R, Nikolich MP, Horswill A, Goglin K
PCM28 vector Map
PCM28 vector Sequence
LOCUS V015587 5594 bp DNA circular SYN 16-MAY-2020 DEFINITION Exported. ACCESSION V015587 VERSION V015587 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 5594) AUTHORS DSouza R, Nikolich MP, Horswill A, Goglin K, Fouts DE. TITLE PCM28: Staphylococcus aureus shuttle vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 5594) AUTHORS DSouza R, Nikolich MP, Horswill A, Goglin K, Fouts DE. TITLE Direct Submission JOURNAL Submitted (16-JAN-2020) Genomic Medicine, J. Craig Venter Institute, 9605 Medical Centre Dr, Rockville, MD 20850, USA REFERENCE 3 (bases 1 to 5594) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Assembly Method :: Unicycler v. 0.4.7 Coverage :: >100X Sequencing Technology :: Illumina ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (16-JAN-2020) Genomic Medicine, J. Craig Venter Institute, 9605 Medical Centre Dr, Rockville, MD 20850, USA" FEATURES Location/Qualifiers source 1..5594 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 560..574 /label="enterokinase site" /note="enterokinase recognition and cleavage site" CDS 592..825 /codon_start=1 /transl_table=11 /product="hypothetical protein" /label="hypothetical protein" /db_xref="SEED:fig|6666666.501693.peg.2" /protein_id="QJS05070.1" /translation="MLKCFIILTLYKHYTFVIQILTLLGTIKNHENFNLHVTGQCLKKS TLNLLKFLFVELEYIYLAHICFLKACMPAGRL" primer_bind complement(863..879) /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" protein_bind complement(887..903) /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(911..941) /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind complement(956..977) /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(1265..1853) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(2027..2884) /label="AmpR" /note="beta-lactamase" promoter complement(2885..2989) /label="AmpR promoter" primer_bind 3463..3479 /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" CDS complement(3546..3686) /codon_start=1 /transl_table=11 /product="hypothetical protein" /label="hypothetical protein" /db_xref="SEED:fig|6666666.501693.peg.4" /protein_id="QJS05072.1" /translation="MIAKNAIPIQNHIPIIDNHITVIKPLLFNKLYHKKYLNFKCLYFE F" CDS complement(3756..3947) /codon_start=1 /transl_table=11 /product="hypothetical protein" /label="hypothetical protein" /db_xref="SEED:fig|6666666.501693.peg.5" /protein_id="QJS05073.1" /translation="MKKVFILQLQIHILLFLNRLLLFRFFIPIALLTLSLGTLNNPKTC RMVGLIAHAMPTFVCKFS" CDS complement(4016..4663) /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" CDS complement(4797..5057) /codon_start=1 /transl_table=11 /product="hypothetical protein" /label="hypothetical protein" /db_xref="SEED:fig|6666666.501693.peg.7" /protein_id="QJS05075.1" /translation="MFFTSHLKRYINRYEKATFFALKTSHTNNLRVTSLAGNSYPYYQD KKEKDFSLRSNPLKKHKRPHFLMWSFILQLKHPLVQQTKIG"
This page is informational only.