Basic Vector Information
- Vector Name:
- pSKA417
- Antibiotic Resistance:
- Streptomycin
- Length:
- 4403 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Aoki SK, Lillacci G, Gupta A, Baumschlager A
pSKA417 vector Map
pSKA417 vector Sequence
LOCUS 62056_19905 4403 bp DNA circular SYN 26-JUN-2019 DEFINITION Cloning vector pSKA417, complete sequence. ACCESSION MK775703 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4403) AUTHORS Aoki SK, Lillacci G, Gupta A, Baumschlager A, Schweingruber D, Khammash M. TITLE A universal biomolecular integral feedback controller for robust perfect adaptation JOURNAL Nature 570, 533-537 (2019) PUBMED 31217585 REFERENCE 2 (bases 1 to 4403) AUTHORS Aoki SK, Lillacci G. TITLE Direct Submission JOURNAL Submitted (09-APR-2019) Biosystems Science and Engineering, ETH Zurich, Mattenstrasse 26, Basel 4058, Switzerland REFERENCE 3 (bases 1 to 4403) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nature 570, 533-537 (2019)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (09-APR-2019) Biosystems Science and Engineering, ETH Zurich, Mattenstrasse 26, Basel 4058, Switzerland" FEATURES Location/Qualifiers source 1..4403 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 7..25 /label=tet operator /note="bacterial operator O2 for the tetR and tetA genes" regulatory 26..31 /regulatory_class="minus_35_signal" regulatory 32..50 /label=TetR tetO2 binding site /note="TetR tetO2 binding site" /regulatory_class="other" regulatory 49..54 /regulatory_class="minus_10_signal" regulatory 67..73 /label=sRBS /note="sRBS" /regulatory_class="ribosome_binding_site" CDS 80..2443 /codon_start=1 /transl_table=11 /product="mfLon" /label=mfLon /protein_id="QDD67903.1" /translation="MSKKIKLPIFQIRGSFIVPGIKENLEVGRKNTLASVNYAIKNSNN QMIAIPQIDASVEKPEFSDLHEFGILIDFEVIKEWKDNSLTISTNPIQRCKVISFFENE DQVPYAEVELIESINDFSDEELKELIEKISDAIKTKASLVTKQIKQLISGESDDLSLAF DSIMFKLAPSKILTNPEYITSPSLKTRWSIIEKIIFAEDGIITRNAESIDAARQKNEIE QELNHKLKEKMDKQQKEYYLREKMRIIKDELEDEDDSDDSSLEKYKERLAKEPFPEEVK RKIMASIKRVEALQSGTPEWNTEKNYIDWMMSIPWWEETEDLTDLKYAKKILDKHHYGM KKVKERIIEYLAVKTKTKSLKAPIITLVGPPGVGKTSLAKSIAEAVGKNFVKVSLGGVK DESEIRGHRKTYVGSMPGRIIQTMKRAKVKNPLFLLDEIDKMASDHRGDPASAMLEVLD PEQNKEFSDHYIEEPYDLSQVMFIATANYPEDIPEALYDRMEIINLSSYTEIEKVKIAQ DYLVPKAIEQHELTSEEISFTEGAINEIIKYYTREAGVRQLERHINSIIRKYIVKNLNG EMDKIVIDEKQVNDLLGKRIFDHTEKQEESQIGVVTGLAYTQFGGDILPIEVSLYPGKG NLILTGKLGEVMKESATIALTYVKSNFEKFGVDKKVFEENDIHVHVPEGAVPKDGPAAG ITITTALISALSDKPVSKEIGMTGEITLRGNVLPIGGLREKSISASRSGLKTIIIPKKN ERDLDEIPDEVKAKLKIIPAEKYEEVFAIVFKTK" terminator 2455..2541 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" rep_origin complement(2711..3256) /direction=LEFT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." terminator complement(3370..3464) /label=lambda t0 terminator /note="transcription terminator from phage lambda" CDS complement(3479..4267) /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)"
This page is informational only.