Basic Vector Information
- Vector Name:
- pEA206
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7861 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Liu C, Lin L, Wang J.
- Promoter:
- ADH1(long)
pEA206 vector Vector Map
pEA206 vector Sequence
LOCUS 62056_8680 7861 bp DNA circular SYN 02-MAR-2020 DEFINITION Cloning vector pEA206, complete sequence. ACCESSION MN161744 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7861) AUTHORS Liu C, Lin L, Wang J. TITLE Absolute quantification of real-time PCR data with stage signal difference analysis JOURNAL Unpublished REFERENCE 2 (bases 1 to 7861) AUTHORS Liu C, Lin L, Wang J. TITLE Direct Submission JOURNAL Submitted (09-JUL-2019) State Key Laboratory of Electroanalytical Chemistry, Changchun Institute of Applied Chemistry, Renmin Street, Changchun, Jilin 130000, China REFERENCE 3 (bases 1 to 7861) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (09-JUL-2019) State Key Laboratory of Electroanalytical Chemistry, Changchun Institute of Applied Chemistry, Renmin Street, Changchun, Jilin 130000, China" COMMENT ##Assembly-Data-START## Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..7861 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 20..38 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" promoter 847..1551 /label=ADH1 promoter /note="promoter for alcohol dehydrogenase 1" CDS 1569..1589 /label=SV40 NLS /note="nuclear localization signal of SV40 (simian virus 40) large T antigen" CDS 1587..2192 /label=LexA /note="E. coli DNA-binding protein that represses genes involved in the SOS response to DNA damage" CDS 2214..4079 /codon_start=1 /transl_table=11 /product="PhyB-N" /label=PhyB-N /protein_id="QID75589.1" /translation="MVSGVGGSGGGRGGGRGGEEEPSSSHTPNNRRGGEQAQSSGTKSL RPRSNTESMSKAIQQYTVDARLHAVFEQSGESGKSFDYSQSLKTTTYGSSVPEQQITAY LSRIQRGGYIQPFGCMIAVDESSFRIIGYSENAREMLGIMPQSVPTLEKPEILAMGTDV RSLFTSSSSILLERAFVAREITLLNPVWIHSKNTGKPFYAILHRIDVGVVIDLEPARTE DPALSIAGAVQSQKLAVRAISQLQALPGGDIKLLCDTVVESVRDLTGYDRVMVYKFHED EHGEVVAESKRDDLEPYIGLHYPATDIPQASRFLFKQNRVRMIVDCNATPVLVVQDDRL TQSMCLVGSTLRAPHGCHSQYMANMGSIASLAMAVIINGNEDDGSNVASGRSSMRLWGL VVCHHTSSRCIPFPLRYACEFLMQAFGLQLNMELQLALQMSEKRVLRTQTLLCDMLLRD SPAGIVTQSPSIMDLVKCDGAAFLYHGKYYPLGVAPSEVQIKDVVEWLLANHADSTGLS TDSLGDAGYPGAAALGDAVCGMAVAYITKRDFLFWFRSHTAKEIKWGGAKHHPEDKDDG QRMHPRSSFQAFLEVVKSRSQPWETAEMDAIHSLQLILRDSFKES" terminator 4117..4304 /label=ADH1 terminator /note="transcription terminator for the S. cerevisiae alcohol dehydrogenase 1 (ADH1) gene" CDS 4337..4360 /label=Xpress(TM) tag /note="Xpress(TM) epitope tag, including an enterokinase recognition and cleavage site" CDS complement(4431..5102) /label=TRP1 /note="phosphoribosylanthranilate isomerase, required for tryptophan biosynthesis" promoter complement(5103..5204) /label=TRP1 promoter terminator 5276..5323 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" rep_origin 5420..5875 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 5901..6005 /label=AmpR promoter CDS 6006..6863 /label=AmpR /note="beta-lactamase" rep_origin 7037..7625 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.