Basic Vector Information
- Vector Name:
- pLSV1
- Antibiotic Resistance:
- Apramycin
- Length:
- 5190 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Li L.
pLSV1 vector Map
pLSV1 vector Sequence
LOCUS 62056_14445 5190 bp DNA circular SYN 13-MAY-2019 DEFINITION Cloning vector pLSV1, complete sequence. ACCESSION MK190412 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5190) AUTHORS Li L. TITLE Direct Submission JOURNAL Submitted (15-NOV-2018) Key Laboratory of Synthetic Biology, Institute of Plant Physiology and Ecology, 300 Feng Lin Road, Shanghai, Shanghai 200032, China REFERENCE 2 (bases 1 to 5190) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (15-NOV-2018) Key Laboratory of Synthetic Biology, Institute of Plant Physiology and Ecology, 300 Feng Lin Road, Shanghai, Shanghai 200032, China" FEATURES Location/Qualifiers source 1..5190 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(224..1867) /codon_start=1 /transl_table=11 /product="SV1 integrase" /label=SV1 integrase /protein_id="QCO69839.1" /translation="MKRDLPSTFRGSRTPGEPWLGYIRVSTWREEKISPELQQSAIESW AARTGRRIVDWIVDLDATGRNFKRKIMGGIQRVEGREAVGIAVWKFSRFGRNDLGIAIN LARLEQAGGDLASATEEVDARTAVGRFNRAILFDLAVFESDRAGEQWKETHAHRRALKL PATGRQRFGYVWHPRRVPDLTAPGGFRLQEERYERHPEFAPVAAELYERKLAGQGFSQL AYWLNDELLIPTTRGNRWGTNTVQRYLDSGFAAGLLRVHDPECRCKLGQDHFSACKENR WLWLPGAQPALIVPEQWKEYGAHREQTRKTPPRARRASYPTSGIMRHGHCRGTAVARSG RDGKGGFVPGHVFVCFNRRNKGKSACEPGLYVRRDEVEAEVLKWLADTVADDIDNAPAL PAQRTAPGTAPDPRARLVEERTRTEAELAKIEGALDRLVTDYALDPDKYPADTFGRVRD QLLGKKGDIIKHLKSLSEVEVAPTREEFRPLIVGLLQEWDILHTTEKNAILRRLLRRLV IHNRKSDQGAQWSVVRSFEFHPVWEPDPWS" primer_bind complement(2092..2108) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(2116..2132) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2140..2170) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(2185..2206) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(2494..3082) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS 3286..4086 /label=ApmR /note="aminoglycoside 3-N-acetyltransferase type IV" CDS complement(4523..4891) /label=traJ /note="oriT-recognizing protein" oriT complement(4924..5033) /direction=LEFT /label=oriT /note="incP origin of transfer"
This page is informational only.