Basic Vector Information
- Vector Name:
- GalR_NAR
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 3796 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Rondon RE, Groseclose TM, Short AE, Wilson CJ.
GalR_NAR vector Map
GalR_NAR vector Sequence
LOCUS 62056_981 3796 bp DNA circular SYN 03-DEC-2019 DEFINITION Cloning vector GalR_NAR, complete sequence. ACCESSION MN207923 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3796) AUTHORS Rondon RE, Groseclose TM, Short AE, Wilson CJ. TITLE Transcriptional programming using engineered systems of transcription factors and genetic architectures JOURNAL Nat Commun 10 (1), 4784 (2019) PUBMED 31636266 REFERENCE 2 (bases 1 to 3796) AUTHORS Rondon RE, Groseclose T, Short A, Wilson CJ. TITLE Direct Submission JOURNAL Submitted (21-JUL-2019) Chemical and Biomolecular Engineering, Georgia Institute of Technology, 950 Atlantic dr. NW, 5110E, Atlanta, GA 30332, United States REFERENCE 3 (bases 1 to 3796) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat Commun"; date: "2019"; volume: "10"; issue: "1"; pages: "4784" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (21-JUL-2019) Chemical and Biomolecular Engineering, Georgia Institute of Technology, 950 Atlantic dr. NW, 5110E, Atlanta, GA 30332, United States" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..3796 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 596..673 /label=lacI promoter CDS 674..1711 /codon_start=1 /transl_table=11 /product="GalR NAR" /label=GalR NAR /protein_id="QFU95511.1" /translation="MKPVTLYDVAEYAGVSNATVSRVVNQASHVSAKTREKVEAAMESL SYHPNANARALAQQTTETVGLVVGDVSDPFFGAMVKAVEQVAYHTGNFLLIGNGYHNEQ KERQAIEQLIRHRCAALVVHAKMIPDADLASLMKQMPGMVLINRILPGFENRCIALDDR YGAWLATRHLIQQGHTRIGYLCSNHSISDAEDRLQGYYDALAESGIAANDRLVTFGEPD ESGGEQAMTELLGRGRNFTAVACYNDSMAAGAMGVLNDNGIDVPGEISLIGFDDVLVSR YVRPRLTTVRYPIVTMATQAAELALALADNRPLPEITNVFSPTLVRRHSVSTPSLEASH HATSD" protein_bind 1752..1773 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin 1964..2508 /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." promoter 3034..3136 /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS 3137..3793 /label=CmR /note="chloramphenicol acetyltransferase"
This page is informational only.