Basic Vector Information
- Vector Name:
- pCasCure-Rif
- Length:
- 9764 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Chen L.
- Promoter:
- araBAD
pCasCure-Rif vector Vector Map
pCasCure-Rif vector Sequence
LOCUS 62056_4905 9764 bp DNA circular SYN 26-MAY-2020 DEFINITION Cloning vector pCasCure-Rif, complete sequence. ACCESSION MT262893 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 9764) AUTHORS Chen L. TITLE CRISPR/Cas9-mediated plasmid curation JOURNAL Unpublished REFERENCE 2 (bases 1 to 9764) AUTHORS Chen L. TITLE Direct Submission JOURNAL Submitted (27-MAR-2020) Center for Discovery and Innovation, Hackensack-Meridian Health, 340 Kingsland Street, Nutley, NJ 07110, USA REFERENCE 3 (bases 1 to 9764) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (27-MAR-2020) Center for Discovery and Innovation, Hackensack-Meridian Health, 340 Kingsland Street, Nutley, NJ 07110, USA" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..9764 /mol_type="other DNA" /organism="synthetic DNA construct" promoter complement(1..105) /label=AmpR promoter primer_bind 579..595 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" primer_bind 633..649 /label=KS primer /note="common sequencing primer, one of multiple similar variants" CDS complement(714..2132) /label=SacB /note="secreted levansucrase that renders bacterial growth sensitive to sucrose" promoter 2518..2552 /label=J23119(SpeI) promoter /note="bacterial promoter (Registry of Standard Biological Parts BBa_J23119) modified to end with an SpeI site" misc_RNA 2570..2645 /label=gRNA scaffold /note="guide RNA scaffold for the Streptococcus pyogenes CRISPR/Cas9 system" primer_bind complement(2678..2694) /label=SK primer /note="common sequencing primer, one of multiple similar variants" CDS complement(2707..6810) /label=Cas9 /note="Cas9 (Csn1) endonuclease from the Streptococcus pyogenes Type II CRISPR/Cas system" promoter complement(6838..7122) /label=araBAD promoter /note="promoter of the L-arabinose operon of E. coli; the araC regulatory gene is transcribed in the opposite direction (Guzman et al., 1995)" CDS 7149..8024 /label=araC /note="L-arabinose regulatory protein" primer_bind complement(8151..8167) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(8175..8191) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(8199..8229) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(8244..8265) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(8553..9141) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(9312..9764) /codon_start=1 /transl_table=11 /product="Arr" /label=Arr /protein_id="QJX58432.1" /translation="MVKDWIPISHDNYKQVQGPFYHGTKANLAIGDLLTTGFISHFEDG RILKHIYFSALMEPAVWGAELAMSLSGLEGRGYIYIVEPTGPFEDDPNLTNKRFPGNPT QSYRTCEPLRIVGVVEDWEGHPVELIRGMLDSLEDLKRRGLHVIED"
This page is informational only.