Basic Vector Information
- Vector Name:
- pJY5
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8679 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Yayo J, Kuil T, Olson DG, Lynd LR
pJY5 vector Map
pJY5 vector Sequence
LOCUS V015504 8679 bp DNA circular SYN 16-FEB-2021
DEFINITION Exported.
ACCESSION V015504
VERSION V015504
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
.
REFERENCE 1 (bases 1 to 8679)
AUTHORS Yayo J, Kuil T, Olson DG, Lynd LR, Holwerda EK, van Maris AJA.
TITLE Laboratory evolution and reverse engineering of Clostridium
thermocellum for growth on glucose and fructose
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 8679)
AUTHORS Yayo J, Kuil T, Olson DG, Lynd LR, Holwerda EK, van Maris AJA.
TITLE Direct Submission
JOURNAL Submitted (09-DEC-2020) Industrial Biotechnology, KTH Royal
Institute of Technology, Roslagstullsbacken 21, Stockholm 11421,
Sweden
REFERENCE 3 (bases 1 to 8679)
AUTHORS .
TITLE Direct Submission
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(09-DEC-2020) Industrial Biotechnology, KTH Royal Institute of
Technology, Roslagstullsbacken 21, Stockholm 11421, Sweden"
FEATURES Location/Qualifiers
source 1..8679
/mol_type="other DNA"
/organism="synthetic DNA construct"
rep_origin 1..455
/label="C. thermocellum origin of replication"
/note="C. thermocellum origin of replication"
CDS 456..1457
/label="repB"
/note="RepB replication protein"
regulatory 1536..2156
/label="C. thermocellum cbp promoter"
/note="C. thermocellum cbp promoter"
/regulatory_class="promoter"
gene 2157..2735
/gene="tdk"
/label="tdk"
CDS 2157..2735
/codon_start=1
/transl_table=11
/gene="tdk"
/product="thymidine kinase"
/label="tdk"
/protein_id="QRQ89499.1"
/translation="MYGPKDHGYIEVVTGPMFSGKSEELIRRIKRAKIARQKVQVFKPA
IDDRYSIDKVVSHNGDNMHAIAIVKASDILAYAEEDTDVFAIDEVQFFDSEIVDIVKEI
ADSGKRVICAGLDMDFRGEPFGPTPELMAIAEFVDKLTAICMKCGNPATRTQRLINGKP
ANYDDPIIMVGAKESYEARCRKCHEVPRT"
rep_origin complement(3002..3547)
/direction=LEFT
/label="p15A ori"
/note="Plasmids containing the medium-copy-number p15A
origin of replication can be propagated in E. coli cells
that contain a second plasmid with the ColE1 origin."
terminator complement(3597..3785)
/label="CYC1 terminator"
/note="transcription terminator for CYC1"
misc_feature complement(3821..4392)
/label="gene target internal homology recombination flank"
/note="gene target internal homology recombination flank"
gene complement(4577..5122)
/gene="hpt"
/label="hpt"
CDS complement(4577..5122)
/codon_start=1
/transl_table=11
/gene="hpt"
/product="hypoxanthine phosphoribosyltransferase"
/label="hpt"
/protein_id="QRQ89500.1"
/translation="MENLSKDIDEILITEEELKEKIKELGRQITKDYKGKNLMLVGVLK
GALMFMADLSRHIDLPLSLDFMAVSSYGSSTHSSGIVKIIKDLDISIEGKDVLIVEDII
DSGLTLSYLRETLLGRKPKSLKICTILDKPERREASVKVDYVGFKIPDKFVVGYGLDFD
EKYRNLPFIGVLKPEMYS"
CDS complement(5143..5790)
/gene="cat"
/label="Chloramphenicol acetyltransferase"
/note="Chloramphenicol acetyltransferase from
Staphylococcus aureus. Accession#: P00485"
regulatory complement(5791..6365)
/label="C. thermocellum gapDH promoter"
/note="C. thermocellum gapDH promoter"
/regulatory_class="promoter"
misc_feature complement(6369..6960)
/label="downstream homology recombination 3' flank"
/note="downstream homology recombination 3' flank"
misc_feature complement(6961..7519)
/label="upstream homology recombination 5' flank"
/note="upstream homology recombination 5' flank"
promoter 7612..7716
/label="AmpR promoter"
CDS 7717..8574
/label="AmpR"
/note="beta-lactamase"
This page is informational only.