pSN-caSAT1 vector (V015484)

LOCUS       62056_20020        5370 bp DNA     circular SYN 03-MAR-2020
DEFINITION  Cloning vector pSN-caSAT1, complete sequence.
ACCESSION   MT001914
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5370)
  AUTHORS   Nemeth T.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-JAN-2020) Department of Microbiology, University of 
            Szeged, Kozep fasor 52, Szeged, Csongrad 6726, Hungary
REFERENCE   2  (bases 1 to 5370)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Submitted 
            (28-JAN-2020) Department of Microbiology, University of Szeged, 
            Kozep fasor 52, Szeged, Csongrad 6726, Hungary"
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: CLC Genomics Workbench v. v11
            Sequencing Technology :: IonTorrent
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..5370
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     protein_bind    107..128
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        143..173
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    181..197
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     205..221
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        239..257
                     /label=SP6 promoter
                     /note="promoter for bacteriophage SP6 RNA polymerase"
     regulatory      335..832
                     /label=Candida albicans ACT1 promoter
                     /note="Candida albicans ACT1 promoter"
                     /regulatory_class="promoter"
     gene            833..2059
                     /gene="caSAT1"
                     /label=caSAT1
     CDS             join(833..842,1497..2059)
                     /codon_start=1
                     /transl_table=11
                     /gene="caSAT1"
                     /product="streptothricin acetyltransferase"
                     /label=caSAT1
                     /note="codon-optimized for Candida albicans"
                     /protein_id="QID92303.1"
                     /translation="MDGEEVAALVIDNGSHMKISVIPEQVAETLDAENHFIVREVFDVH
                     LSDQGFELSTRSVSPYRKDYISDDDSDEDSACYGAFIDQELVGKIELNSTWNDLASIEH
                     IVVSHTHRGKGVAHSLIEFAKKWALSRQLLGIRLETQTNNVPACNLYAKCGFTLGGIDL
                     FTYKTRPQVSNETAMYWYWFSGAQDDA"
     regulatory      2063..2192
                     /label=Candida albicans URA3 terminator
                     /note="Candida albicans URA3 terminator"
                     /regulatory_class="terminator"
     promoter        complement(2258..2276)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(2283..2299)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             2437..2736
                     /label=ccdB
                     /note="CcdB, a bacterial toxin that poisons DNA gyrase"
     CDS             3088..3879
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"
     CDS             4089..4460
                     /label=BleoR
                     /note="antibiotic-binding protein"
     rep_origin      4601..5189
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"