Basic Vector Information
- Vector Name:
- pSN-caSAT1
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5370 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Nemeth T.
- Promoter:
- SP6
pSN-caSAT1 vector Vector Map
pSN-caSAT1 vector Sequence
LOCUS 62056_20020 5370 bp DNA circular SYN 03-MAR-2020 DEFINITION Cloning vector pSN-caSAT1, complete sequence. ACCESSION MT001914 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5370) AUTHORS Nemeth T. TITLE Direct Submission JOURNAL Submitted (28-JAN-2020) Department of Microbiology, University of Szeged, Kozep fasor 52, Szeged, Csongrad 6726, Hungary REFERENCE 2 (bases 1 to 5370) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (28-JAN-2020) Department of Microbiology, University of Szeged, Kozep fasor 52, Szeged, Csongrad 6726, Hungary" COMMENT ##Assembly-Data-START## Assembly Method :: CLC Genomics Workbench v. v11 Sequencing Technology :: IonTorrent ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..5370 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 107..128 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 143..173 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 181..197 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 205..221 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" promoter 239..257 /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase" regulatory 335..832 /label=Candida albicans ACT1 promoter /note="Candida albicans ACT1 promoter" /regulatory_class="promoter" gene 833..2059 /gene="caSAT1" /label=caSAT1 CDS join(833..842,1497..2059) /codon_start=1 /transl_table=11 /gene="caSAT1" /product="streptothricin acetyltransferase" /label=caSAT1 /note="codon-optimized for Candida albicans" /protein_id="QID92303.1" /translation="MDGEEVAALVIDNGSHMKISVIPEQVAETLDAENHFIVREVFDVH LSDQGFELSTRSVSPYRKDYISDDDSDEDSACYGAFIDQELVGKIELNSTWNDLASIEH IVVSHTHRGKGVAHSLIEFAKKWALSRQLLGIRLETQTNNVPACNLYAKCGFTLGGIDL FTYKTRPQVSNETAMYWYWFSGAQDDA" regulatory 2063..2192 /label=Candida albicans URA3 terminator /note="Candida albicans URA3 terminator" /regulatory_class="terminator" promoter complement(2258..2276) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(2283..2299) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS 2437..2736 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" CDS 3088..3879 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" CDS 4089..4460 /label=BleoR /note="antibiotic-binding protein" rep_origin 4601..5189 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.