Basic Vector Information
- Vector Name:
- pMSx80
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5473 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Scheller L, Schmollack M, Bertschi A, Mansouri M
- Promoter:
- SV40
pMSx80 vector Vector Map
pMSx80 vector Sequence
LOCUS 62056_17425 5473 bp DNA circular SYN 30-JUN-2020 DEFINITION Cloning vector pMSx80, complete sequence. ACCESSION MT267326 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5473) AUTHORS Scheller L, Schmollack M, Bertschi A, Mansouri M, Saxena P, Fussenegger M. TITLE Phosphoregulated orthogonal signal transduction in mammalian cells JOURNAL Nat Commun 11 (1), 3085 (2020) PUBMED 32555187 REFERENCE 2 (bases 1 to 5473) AUTHORS Scheller L. TITLE Direct Submission JOURNAL Submitted (29-MAR-2020) STI IBI-STI LPDI, EPFL, AI 3123 (Batiment AI), Station 19, Lausanne 1015, Switzerland REFERENCE 3 (bases 1 to 5473) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat Commun"; date: "2020"; volume: "11"; issue: "1"; pages: "3085" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (29-MAR-2020) STI IBI-STI LPDI, EPFL, AI 3123 (Batiment AI), Station 19, Lausanne 1015, Switzerland" FEATURES Location/Qualifiers source 1..5473 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 1..9 /label=SV40 polyA /note="SV40 polyA" primer_bind complement(49..65) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(73..89) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(97..127) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(142..163) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(451..1036) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(1210..2067) /label=AmpR /note="beta-lactamase" promoter complement(2068..2172) /label=AmpR promoter misc_feature 2241..2444 /label=SV40 early promoter /note="SV40 early promoter" promoter 2494..2512 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" misc_feature 2541..2546 /label=Kozak+ATG /note="Kozak+ATG" CDS 2544..3239 /codon_start=1 /transl_table=11 /product="truncated EnvZ" /label=truncated EnvZ /protein_id="QKE44365.1" /translation="MTSDDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKD IEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREIETALYPGSIEVKM HPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIAPEQRKHLFQPFV RGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVPVTRAQGTTKEG ASASGSTGV" misc_feature 2553..3209 /label=envZ 232-450 /note="envZ 232-450" misc_feature 2730..2747 /label=linker acceptor-ATP binding /note="linker acceptor-ATP binding" polyA_signal 3276..3500 /label=bGH poly(A) signal /note="bovine growth hormone polyadenylation signal" rep_origin 3546..3974 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 3988..4317 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 4384..5175 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" polyA_signal 5352..5473 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal"
This page is informational only.