Basic Vector Information
- Vector Name:
- pHal2-FAPG462VRFP
- Antibiotic Resistance:
- Streptomycin
- Length:
- 7889 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Trisrivirat D, Hughes JMX., Hoeven R, Faulkner M
pHal2-FAPG462VRFP vector Map
pHal2-FAPG462VRFP vector Sequence
LOCUS 62056_12140 7889 bp DNA circular SYN 14-DEC-2020 DEFINITION Cloning vector pHal2-FAPG462VRFP, complete sequence. ACCESSION MW076828 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7889) AUTHORS Trisrivirat D, Hughes JMX., Hoeven R, Faulkner M, Toogood H, Chaiyen P, Scrutton NS. TITLE Promoter engineering for microbial bio-alkane gas production JOURNAL Synth Biol (Oxf) 5 (1), ysaa022 (2020) PUBMED 33263086 REFERENCE 2 (bases 1 to 7889) AUTHORS Trisrivirat D, Hughes JMX., Hoeven R, Faulkner M, Toogood HS, Chaiyen P, Scrutton NS. TITLE Direct Submission JOURNAL Submitted (06-OCT-2020) Chemistry, University of Manchester, 131 Princess Street, Manchester, Lancashire M1 7DN, United Kingdom REFERENCE 3 (bases 1 to 7889) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Synth Biol (Oxf)"; date: "2020"; volume: "5"; issue: "1"; pages: "ysaa022" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (06-OCT-2020) Chemistry, University of Manchester, 131 Princess Street, Manchester, Lancashire M1 7DN, United Kingdom" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..7889 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 1028..1130 /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS 1350..2138 /codon_start=1 /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)" /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK" oriT 2319..2427 /label=oriT /note="incP origin of transfer" rep_origin 2521..3109 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3166..3996) /codon_start=1 /label=pRO1600 Rep /note="replication protein for the broad-host-range plasmid pRO1600 from Pseudomonas aeruginosa" /translation="VASPPMVYKSNALVEAAYRLSVQEQRIVLACISQVKRSEPVTDEV MYSVTAEDIATMAGVPIESSYNQLKEAALRLKRREVRLTQEPNGKGKRPSVMITGWVQT IIYREGEGRVELRFTKDMLPYLTELTKQFTKYALADVAKMDSTHAIRLYELLMQWDSIG QREIEIDQLRKWFQLEGRYPSIKDFKLRVLDPAVTQINEHSPLQVEWAQRKTGRKVTHL LFSFGPKKPAKAVGKAPAKRKAGKISDAEIAKQARPGETWEAARARLTQMPLDLA" rep_origin 4010..4361 /label=pRO1600 oriV /note="broad-host-range origin of replication from Pseudomonas aeruginosa plasmid pRO1600; requires the pRO1600 Rep protein for replication (West et al., 1994)" terminator complement(4434..4520) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" protein_bind complement(4637..4656) /label=lac operator (symmetric) /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG). The symmetric lac operator was optimized for tight binding of lac repressor." misc_RNA 4658..4708 /label=sTRSV HHRz /note="hammerhead ribozyme from the tobacco ringspot virus satellite RNA (Khvorova et al., 2003)" RBS 4758..4780 /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" CDS 6605..7279 /codon_start=1 /label=mRFP1 /note="monomeric derivative of DsRed (Campbell et al., 2002)" /translation="MASSEDVIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGTQTAK LKVTKGGPLPFAWDILSPQFQYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGV VTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASTERMYPEDGALKGEIKM RLKLKDGGHYDAEVKTTYMAKKPVQLPGAYKTDIKLDITSHNEDYTIVEQYERAEGRHS TGA" CDS 7295..7339 /codon_start=1 /label=S-Tag /note="affinity and epitope tag derived from pancreatic ribonuclease A" /translation="KETAAAKFERQHMDS" terminator 7448..7542 /label=lambda t0 terminator /note="transcription terminator from phage lambda" CDS join(7651..7889,1..574) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
This page is informational only.