Basic Vector Information
- Vector Name:
- pFA-myc-URA3-Clox
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7219 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Duenas-Santero E, Santos-Almeida A, Rojo-Dominguez P, del Rey F
- Promoter:
- T7
pFA-myc-URA3-Clox vector Map
pFA-myc-URA3-Clox vector Sequence
LOCUS V015397 7219 bp DNA circular SYN 17-JUL-2019 DEFINITION Exported. ACCESSION V015397 VERSION V015397 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 7219) AUTHORS Duenas-Santero E, Santos-Almeida A, Rojo-Dominguez P, del Rey F, Correa-Bordes J, Vazquez de Aldana CR. TITLE A new toolkit for gene tagging in Candida albicans containing recyclable markers JOURNAL PLoS ONE (2019) In press REFERENCE 2 (bases 1 to 7219) AUTHORS Duenas-Santero E, Santos-Almeida A, Rojo-Dominguez P, del Rey F, Correa-Bordes J, Vazquez de Aldana CR. TITLE Direct Submission JOURNAL Submitted (18-MAR-2019) Instituto de Biologia Funcional y Genomica (IBFG), Consejo Superior de Investigaciones Cientificas, Zacarias Gonzalez 2, Salamanca, Salamanca 37007, Spain REFERENCE 3 (bases 1 to 7219) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Assembly Method :: Lasergene v. 13 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE (2019) In press" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (18-MAR-2019) Instituto de Biologia Funcional y Genomica (IBFG), Consejo Superior de Investigaciones Cientificas, Zacarias Gonzalez 2, Salamanca, Salamanca 37007, Spain" FEATURES Location/Qualifiers source 1..7219 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 56..85 /label="Myc" /note="Myc (human c-Myc proto-oncogene) epitope tag" regulatory 224..479 /note="Transcriptional termination from Saccharomyces cerevisiae URA3 gene" /regulatory_class="terminator" primer_bind 509..525 /label="SK primer" /note="common sequencing primer, one of multiple similar variants" misc_feature 539..572 /label="loxP" /note="loxP" CDS 1002..1811 /gene="URA3" /label="Orotidine 5'-phosphate decarboxylase" /note="Orotidine 5'-phosphate decarboxylase from Candida albicans (strain SC5314 / ATCC MYA-2876). Accession#: P13649" regulatory 1956..3287 /note="CaMET3 promoter; inducible upon growth without methionine repressible via addition of methionine and cysteine to the medium" /regulatory_class="promoter" CDS join(3315..3718,3883..4510) /codon_start=1 /transl_table=11 /product="Cre" /label="Cre" /note="Cre recombinase" /protein_id="QDK59788.1" /translation="MSNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKML LSVCRSWAAWCKLNNRKWFPAEPEDVRDYLLYLQARGLAVKTIQQHLGQLNMLHRRSGL PRPSDSNAVSLVMRRIRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRNLAF LGIAYNTLLRIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTKLVE RWISVSGVADDPNNYLFCRVRKNGVAAPSATSQLSTRALEGIFEATHRLIYGAKDDSGQ RYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNVNIVMNYIRNLDSETGAMVRLLE DGD" intron 3719..3882 /note="modified TUB2 intron sequence" 3'UTR 4523..4653 /label="Saccharomyces cerevisiae ADH1 3'UTR region" /note="Saccharomyces cerevisiae ADH1 3'UTR region" regulatory 4654..4713 /note="Transcriptional termination from Saccharomyces cerevisiae CYC1 gene" /regulatory_class="terminator" protein_bind complement(4726..4759) /label="loxP" /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." promoter complement(4857..4875) /label="T7 promoter" /note="promoter for bacteriophage T7 RNA polymerase" rep_origin complement(5133..5721) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5895..6752) /label="AmpR" /note="beta-lactamase" promoter complement(6753..6857) /label="AmpR promoter" promoter 7203..7219 /label="SP6 promoter" /note="promoter for bacteriophage SP6 RNA polymerase"
This page is informational only.