Basic Vector Information
- Vector Name:
- pJY16
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9728 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Yayo J, Kuil T, Olson DG, Lynd LR
pJY16 vector Map
pJY16 vector Sequence
LOCUS V015364 9728 bp DNA circular SYN 16-FEB-2021 DEFINITION Exported. ACCESSION V015364 VERSION V015364 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 9728) AUTHORS Yayo J, Kuil T, Olson DG, Lynd LR, Holwerda EK, van Maris AJA. TITLE Laboratory evolution and reverse engineering of Clostridium thermocellum for growth on glucose and fructose JOURNAL Unpublished REFERENCE 2 (bases 1 to 9728) AUTHORS Yayo J, Kuil T, Olson DG, Lynd LR, Holwerda EK, van Maris AJA. TITLE Direct Submission JOURNAL Submitted (09-DEC-2020) Industrial Biotechnology, KTH Royal Institute of Technology, Roslagstullsbacken 21, Stockholm 11421, Sweden REFERENCE 3 (bases 1 to 9728) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (09-DEC-2020) Industrial Biotechnology, KTH Royal Institute of Technology, Roslagstullsbacken 21, Stockholm 11421, Sweden" FEATURES Location/Qualifiers source 1..9728 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 1..455 /label="C. thermocellum origin of replication" /note="C. thermocellum origin of replication" CDS 456..1457 /label="repB" /note="RepB replication protein" regulatory 1536..2156 /label="C. thermocellum cbp promoter" /note="C. thermocellum cbp promoter" /regulatory_class="promoter" gene 2157..2735 /gene="tdk" /label="tdk" CDS 2157..2735 /codon_start=1 /transl_table=11 /gene="tdk" /product="thymidine kinase" /label="tdk" /protein_id="QRQ89514.1" /translation="MYGPKDHGYIEVVTGPMFSGKSEELIRRIKRAKIARQKVQVFKPA IDDRYSIDKVVSHNGDNMHAIAIVKASDILAYAEEDTDVFAIDEVQFFDSEIVDIVKEI ADSGKRVICAGLDMDFRGEPFGPTPELMAIAEFVDKLTAICMKCGNPATRTQRLINGKP ANYDDPIIMVGAKESYEARCRKCHEVPRT" rep_origin complement(3002..3547) /direction=LEFT /label="p15A ori" /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." terminator complement(3597..3785) /label="CYC1 terminator" /note="transcription terminator for CYC1" misc_feature complement(3821..4409) /label="upstream homology recombination 5' flank" /note="upstream homology recombination 5' flank" gene complement(4594..5139) /gene="hpt" /label="hpt" CDS complement(4594..5139) /codon_start=1 /transl_table=11 /gene="hpt" /product="hypoxanthine phosphoribosyltransferase" /label="hpt" /protein_id="QRQ89515.1" /translation="MENLSKDIDEILITEEELKEKIKELGRQITKDYKGKNLMLVGVLK GALMFMADLSRHIDLPLSLDFMAVSSYGSSTHSSGIVKIIKDLDISIEGKDVLIVEDII DSGLTLSYLRETLLGRKPKSLKICTILDKPERREASVKVDYVGFKIPDKFVVGYGLDFD EKYRNLPFIGVLKPEMYS" CDS complement(5160..5807) /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" regulatory complement(5808..6382) /label="C. thermocellum gapDH promoter" /note="C. thermocellum gapDH promoter" /regulatory_class="promoter" misc_feature complement(6386..7007) /label="downstream homology recombination 3' flank" /note="downstream homology recombination 3' flank" gene 7014..7979 /gene="cbpA" /label="cbpA" /note="gene target with single-point mutation c.443G>T resulting in G148V" CDS 7014..7979 /codon_start=1 /transl_table=11 /gene="cbpA" /product="carbohydrate binding protein A" /label="cbpA" /note="gene target CDS with single-point mutation c.443G>T resulting in G148V" /protein_id="QRQ89517.1" /translation="MKRFLVLLLAISLIFTFTACNSGSGSGNGQAKGYVGDPSDEYYMV TFLSGIDYWKYCFEGFEDAAKAIGVTAKYTGQTDTDVSGQVAVLEQVIAQKPKGIAVTA VNSTALADTINSAIEQGISVVCFDSDSPTSNRSAYLGTGNYAAVQKAAEFLVPLVNYKG KIAVLYTVGAENSESRVQGFEDWCKQNAPEVSLVKVNDAGDTTVAADNLAAALQANDDI VGVFCVDGVAGTAGPTAVAESKKDLRVLAFDVDVTVLDKVKSGEIDGTVAQGMYNMGYW SLMMLYTEANGLSSKALPGNLDTGVVIVTKDNVDEYYPKK" misc_feature complement(7980..8568) /label="upstream homology recombination 5' flank" /note="upstream homology recombination 5' flank" promoter 8661..8765 /label="AmpR promoter" CDS 8766..9623 /label="AmpR" /note="beta-lactamase"
This page is informational only.