Basic Vector Information
- Vector Name:
- pBGC
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 4102 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Alonso-del Valle A, Leon-Sampedro R, Rodriguez-Beltran J, DelaFuente J
- Promoter:
- araBAD
pBGC vector Map
pBGC vector Sequence
LOCUS 62056_3830 4102 bp DNA circular SYN 09-DEC-2020 DEFINITION Cloning vector pBGC, complete sequence. ACCESSION MT702881 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4102) AUTHORS Alonso-del Valle A, Leon-Sampedro R, Rodriguez-Beltran J, DelaFuente J, Hernandez-Garcia M, Ruiz-Garbajosa P, Canton R, Pena-Miller R, Millan AS. TITLE The distribution of plasmid fitness effects explains plasmid persistence in bacterial communities JOURNAL bioRxiv (2020) In press REFERENCE 2 (bases 1 to 4102) AUTHORS Alonso-del Valle A. TITLE Direct Submission JOURNAL Submitted (30-JUN-2020) Microbiology Service-Plasmid Biology and Evolution Lab, Ramon y Cajal Health Research Institute (IRyCIS), Ctra. Colmenar Viejo Km 9, 100, Madrid 28034, Spain REFERENCE 3 (bases 1 to 4102) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "bioRxiv (2020) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (30-JUN-2020) Microbiology Service-Plasmid Biology and Evolution Lab, Ramon y Cajal Health Research Institute (IRyCIS), Ctra. Colmenar Viejo Km 9, 100, Madrid 28034, Spain" FEATURES Location/Qualifiers source 1..4102 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 4..106 /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS 107..763 /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" rep_origin 827..1371 /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." protein_bind 1742..1763 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 1778..1808 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 1816..1832 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 1840..1856 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS complement(1889..2764) /codon_start=1 /label=araC /note="L-arabinose regulatory protein" /translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYW HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE EKVNDVAVKLS" promoter 2791..3075 /label=araBAD promoter /note="promoter of the L-arabinose operon of E. coli; the araC regulatory gene is transcribed in the opposite direction (Guzman et al., 1995)" CDS 3133..3846 /codon_start=1 /label=GFP /note="Aequorea victoria green fluorescent protein" /translation="MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK FICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDG NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKV NFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLE FVTAAGITHGMDELYK" terminator 4001..4028 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene"
This page is informational only.