pTlacPC9 vector (V015351)

LOCUS       V015351                 6050 bp    DNA     circular SYN 08-JUL-2019
DEFINITION  Exported.
ACCESSION   V015351
VERSION     V015351
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 6050)
  AUTHORS   Bosse JT, Li Y, Leanse LG, Zhou L, Chaudhuri RR, Peters SE, Wang J,
            Maglennon GA, Holden MTG., Maskell DJ, Tucker AW, Wren BW, Rycroft
            AN, Langford PR.
  TITLE     Rationally designed mariner vectors to allow functional genomic
            analysis of Actinobacillus pleuropneumoniae and other bacteria by
            transposon-directed insertion-site sequencing (TraDIS)
  JOURNAL   bioRxivorg (2019) In press
REFERENCE   2  (bases 1 to 6050)
  AUTHORS   Bosse JT.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-JUL-2018) Medicine, Imperial College London, Norfolk
            Place, London W2 1PG, UK
REFERENCE   3  (bases 1 to 6050)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "bioRxivorg
            (2019) In press"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (17-JUL-2018) Medicine, Imperial College London, Norfolk Place,
            London W2 1PG, UK"
FEATURES             Location/Qualifiers
     source          1..6050
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     protein_bind    35..56
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        71..101
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    109..125
                     /label="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     133..149
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     CDS             186..1232
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /label="transposase"
                     /note="C9 mutant transposase from Himar1"
                     /protein_id="QDH76841.1"
                     /translation="MEKKEFRVLIKYCFLKGKNTVEAKTWLDNEFPDSAPGKSTIIDWY
                     AKFKRGEMSTEDGERSGRPKEVVTDENIKKIHKMILNDRKMKLIEIAEALKISKERVGH
                     IIHQYLDMRKLCAKWVPRELTFDQKQRRVDDSKRCLQLLTRNTPEFFRRYVTMDETWLH
                     HYTPESNRQSAEWTATGEPSPKRGKTQKSAGKVMASVFWDAHGIIFIDYLEKGKTINSD
                     YYMALLERLKVEIAAKRPHMKKKKVLFHQDNAPCHKSLRTMAKIHELGFELLPHPPYSP
                     DLAPSDFFLFSDIKRMLAGKKFGCNEEVIAETEAYFEAKPKEYYQNGIKKLEGRYNRCI
                     ALEGNYVE"
     repeat_region   1334..1362
                     /label="Himar1 IR left"
                     /note="Himar1 IR left"
     misc_feature    1390..1401
                     /label="DNA uptake sequence (DUS) for Neisseria species"
                     /note="DNA uptake sequence (DUS) for Neisseria species"
     misc_feature    1400..1408
                     /note="DNA uptake signal sequence (USS) for Haemophilus
                     influenza"
     misc_feature    1409..1417
                     /note="DNA uptake signal sequence (USS) for Actinobacillus
                     pleuropneumoniae"
     CDS             1587..2234
                     /gene="cat"
                     /label="Chloramphenicol acetyltransferase"
                     /note="Chloramphenicol acetyltransferase from
                     Staphylococcus aureus. Accession#: P00485"
     misc_feature    2308..2316
                     /note="DNA uptake signal sequence (USS) for Actinobacillus
                     pleuropneumoniae"
     misc_feature    2316..2327
                     /label="DNA uptake sequence (DUS) for Neisseria species"
                     /note="DNA uptake sequence (DUS) for Neisseria species"
     misc_feature    2328..2336
                     /note="DNA uptake signal sequence (USS) for Haemophilus
                     influenza"
     repeat_region   2339..2367
                     /label="Himar1 IR right"
                     /note="Himar1 IR right"
     oriT            2585..2694
                     /label="oriT"
                     /note="incP origin of transfer"
     CDS             2727..3095
                     /label="traJ"
                     /note="oriT-recognizing protein"
     promoter        complement(3175..3193)
                     /label="SP6 promoter"
                     /note="promoter for bacteriophage SP6 RNA polymerase"
     primer_bind     complement(3211..3227)
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     protein_bind    complement(3235..3251)
                     /label="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(3259..3289)
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(3304..3325)
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(3613..4201)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(4375..5232)
                     /label="AmpR"
                     /note="beta-lactamase"
     promoter        complement(5233..5337)
                     /label="AmpR promoter"
     rep_origin      complement(5415..5870)
                     /direction=LEFT
                     /label="f1 ori"
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     primer_bind     6011..6027
                     /label="M13 fwd"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     promoter        6034..6050
                     /label="T7 promoter"
                     /note="promoter for bacteriophage T7 RNA polymerase"