Basic Vector Information
- Vector Name:
- pDIS-NAT1-Clox
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9771 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Duenas-Santero E, Santos-Almeida A, Rojo-Dominguez P, del Rey F
- Promoter:
- TEF
pDIS-NAT1-Clox vector Vector Map
pDIS-NAT1-Clox vector Sequence
LOCUS 62056_8465 9771 bp DNA circular SYN 17-JUL-2019 DEFINITION Cloning vector pDIS-NAT1-Clox, complete sequence. ACCESSION MK652134 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 9771) AUTHORS Duenas-Santero E, Santos-Almeida A, Rojo-Dominguez P, del Rey F, Correa-Bordes J, Vazquez de Aldana CR. TITLE A new toolkit for gene tagging in Candida albicans containing recyclable markers JOURNAL PLoS ONE (2019) In press REFERENCE 2 (bases 1 to 9771) AUTHORS Duenas-Santero E, Santos-Almeida A, Rojo-Dominguez P, del Rey F, Correa-Bordes J, Vazquez de Aldana CR. TITLE Direct Submission JOURNAL Submitted (18-MAR-2019) Instituto de Biologia Funcional y Genomica (IBFG), Consejo Superior de Investigaciones Cientificas, Zacarias Gonzalez 2, Salamanca, Salamanca 37007, Spain REFERENCE 3 (bases 1 to 9771) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE (2019) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (18-MAR-2019) Instituto de Biologia Funcional y Genomica (IBFG), Consejo Superior de Investigaciones Cientificas, Zacarias Gonzalez 2, Salamanca, Salamanca 37007, Spain" COMMENT ##Assembly-Data-START## Assembly Method :: Lasergene v. 13 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..9771 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature complement(166..465) /label=NEUT5L 3' /note="NEUT5L 3'" primer_bind 736..752 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 759..777 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind 817..833 /label=SK primer /note="common sequencing primer, one of multiple similar variants" misc_feature 847..880 /label=loxP /note="loxP" terminator complement(1291..1488) /label=TEF terminator /note="Ashbya gossypii TEF terminator" CDS complement(1506..2069) /label=NrsR /note="nourseothricin acetyltransferase" promoter complement(2089..2432) /label=TEF promoter /note="Ashbya gossypii TEF promoter" regulatory 2496..3827 /note="CaMET3 promoter; inducible upon growth without methionine repressible via addition of methionine and cysteine to the medium" /regulatory_class="promoter" CDS join(3855..4258,4423..5050) /codon_start=1 /transl_table=11 /product="Cre" /label=Cre /note="Cre recombinase" /protein_id="QDK59800.1" /translation="MSNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKML LSVCRSWAAWCKLNNRKWFPAEPEDVRDYLLYLQARGLAVKTIQQHLGQLNMLHRRSGL PRPSDSNAVSLVMRRIRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRNLAF LGIAYNTLLRIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTKLVE RWISVSGVADDPNNYLFCRVRKNGVAAPSATSQLSTRALEGIFEATHRLIYGAKDDSGQ RYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNVNIVMNYIRNLDSETGAMVRLLE DGD" intron 4259..4422 /note="modified TUB2 intron sequence" 3'UTR 5063..5139 /label=Saccharomyces cerevisiae ADH1 3'UTR region /note="Saccharomyces cerevisiae ADH1 3'UTR region" regulatory 5194..5253 /note="Transcriptional termination from Saccharomyces cerevisiae CYC1 gene" /regulatory_class="terminator" protein_bind complement(5266..5299) /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." primer_bind complement(5379..5395) /label=KS primer /note="common sequencing primer, one of multiple similar variants" misc_feature complement(5406..5655) /label=NEUT5L 5' /note="NEUT5L 5'" promoter complement(5670..5700) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(5715..5736) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(6024..6612) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(6786..7643) /label=AmpR /note="beta-lactamase" promoter complement(7644..7748) /label=AmpR promoter misc_feature 7785..8288 /label=CEN/ARS /note="S. cerevisiae CEN6 centromere fused to an autonomously replicating sequence" promoter 8544..8824 /label=TRP1 promoter CDS 8825..9496 /label=TRP1 /note="phosphoribosylanthranilate isomerase, required for tryptophan biosynthesis"
This page is informational only.