Basic Vector Information
- Vector Name:
- 4-UBI-NPTII-PINII
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5780 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Gao H.
- Promoter:
- Ubi
4-UBI-NPTII-PINII vector Map
4-UBI-NPTII-PINII vector Sequence
LOCUS 62056_146 5780 bp DNA circular SYN 19-MAR-2020 DEFINITION Cloning vector 4-UBI:NPTII:PINII, complete sequence. ACCESSION MN294716 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5780) AUTHORS Gao H. TITLE Direct Submission JOURNAL Submitted (08-AUG-2019) Molecular Engineering in AST, Corteva Agriscience, 8305 NW 62nd Ave., Johnston, IA 50131, USA REFERENCE 2 (bases 1 to 5780) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (08-AUG-2019) Molecular Engineering in AST, Corteva Agriscience, 8305 NW 62nd Ave., Johnston, IA 50131, USA" COMMENT ##Assembly-Data-START## Assembly Method :: Vector NTI v. 10 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..5780 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind complement(256..355) /label=attL2 /note="recombination site for the Gateway(R) LR reaction" promoter complement(373..391) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(396..412) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 525..1331 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 1481..2069 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" terminator complement(2399..2426) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(2518..2604) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" primer_bind 2668..2684 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" protein_bind 2700..2799 /label=attL1 /note="recombination site for the Gateway(R) LR reaction" promoter 2834..4825 /label=Ubi promoter /note="maize polyubiquitin gene promoter" CDS 4850..5638 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase from Tn5" /translation="VEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRPV LFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLSS HLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQG LAPAELFARLKARMPDGDDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIAL ATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
This page is informational only.