Basic Vector Information
- Vector Name:
- pEM003
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6447 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Mancera E, Frazer C, Porman AM, Ruiz-Castro S
- Promoter:
- lac
pEM003 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pEM003 vector Sequence
LOCUS 62056_9145 6447 bp DNA circular SYN 14-APR-2019 DEFINITION Cloning vector pEM003, complete sequence. ACCESSION MK425747 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6447) AUTHORS Mancera E, Frazer C, Porman AM, Ruiz-Castro S, Johnson AD, Bennett RJ. TITLE Genetic Modification of Closely Related Candida Species JOURNAL Front Microbiol 10, 357 (2019) PUBMED 30941104 REFERENCE 2 (bases 1 to 6447) AUTHORS Mancera E, Frazer C, Porman AM, Ruiz S, Johnson AD, Bennett RJ. TITLE Direct Submission JOURNAL Submitted (22-JAN-2019) Departmento de Ingenieria Genetica, Centro de Investigacion y de Estudios Avanzados del Instituto Politecnico Nacional, Unidad Irapuato, Km. 9.6 Libramiento Norte Carrera Irapuato-Leon, Irapuato, Guanajuato 36824, Mexico REFERENCE 3 (bases 1 to 6447) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Front Microbiol 10, 357 (2019)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (22-JAN-2019) Departmento de Ingenieria Genetica, Centro de Investigacion y de Estudios Avanzados del Instituto Politecnico Nacional, Unidad Irapuato, Km. 9.6 Libramiento Norte Carrera Irapuato-Leon, Irapuato, Guanajuato 36824, Mexico" FEATURES Location/Qualifiers source 1..6447 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 107..128 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 143..173 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 181..197 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 205..221 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" promoter 239..257 /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase" gene 337..3264 /gene="ARG4" /label=ARG4 /note="derived from Candida albicans" misc_feature 337..1321 /gene="ARG4" /label=contains promoter and 5' UTR /note="contains promoter and 5' UTR" CDS 1322..2728 /codon_start=1 /transl_table=11 /gene="ARG4" /product="argininosuccinate lyase" /label=ARG4 /protein_id="QBY25889.1" /translation="MSQQQDKQPSENKLWGGRFTGATDPLMDLYNASLPYDKVMYDADL TGTKVYTQGLNKLGLITTEELHLIHQGLEQIRQEWHDNKFIIKAGDEDIHTANERRLGE IIGKNISGKVHTGRSRNDQVATDMRIFVRESLLNLSKILHQFITAILERAHKEIDVLMP GYTHLQKAQPIRWAHWLSSYATYFTEDYKRLQEIITRVNQSPLGSGALAGHPYGIDREF LAKGLGFDGVIGNSLTAVSDRDFVVESLFWSTLFMNHISRFSEDLIIYSSGEFGFIKLA DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGQLSGFLMSIKSIPSTYNKDMQEDKEPLF DALTTVEHSILIATGVISTLLIDKQNMEKALTMDMLATDLADYLVRKGVPFRETHHISG ECVRKAEEEKLSGIDQLSFEQFQQIDSRFEKDVMETFDFEASVERRDAIGGTAKSAVLK QLENLKSILS" misc_feature 2729..3264 /gene="ARG4" /label=contains 3' UTR and terminator /note="contains 3' UTR and terminator" promoter complement(3335..3353) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(3360..3376) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS 3514..3813 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" CDS 4165..4956 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" CDS 5166..5537 /label=BleoR /note="antibiotic-binding protein" rep_origin 5678..6266 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.