GalR_HQN vector (V015303)

LOCUS       62056_966        3796 bp DNA     circular SYN 03-DEC-2019
DEFINITION  Cloning vector GalR_HQN, complete sequence.
ACCESSION   MN207924
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3796)
  AUTHORS   Rondon RE, Groseclose TM, Short AE, Wilson CJ.
  TITLE     Transcriptional programming using engineered systems of 
            transcription factors and genetic architectures
  JOURNAL   Nat Commun 10 (1), 4784 (2019)
  PUBMED    31636266
REFERENCE   2  (bases 1 to 3796)
  AUTHORS   Rondon RE, Groseclose T, Short A, Wilson CJ.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUL-2019) Chemical and Biomolecular Engineering, 
            Georgia Institute of Technology, 950 Atlantic dr. NW, 5110E, 
            Atlanta, GA 30332, United States
REFERENCE   3  (bases 1 to 3796)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Nat 
            Commun"; date: "2019"; volume: "10"; issue: "1"; pages: "4784"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (21-JUL-2019) Chemical and Biomolecular Engineering, Georgia 
            Institute of Technology, 950 Atlantic dr. NW, 5110E, Atlanta, GA 
            30332, United States"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..3796
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        596..673
                     /label=lacI promoter
     CDS             674..1711
                     /codon_start=1
                     /transl_table=11
                     /product="GalR HQN"
                     /label=GalR HQN
                     /protein_id="QFU95513.1"
                     /translation="MKPVTLYDVAEYAGVSHQTVSNVVNQASHVSAKTREKVEAAMESL
                     SYHPNANARALAQQTTETVGLVVGDVSDPFFGAMVKAVEQVAYHTGNFLLIGNGYHNEQ
                     KERQAIEQLIRHRCAALVVHAKMIPDADLASLMKQMPGMVLINRILPGFENRCIALDDR
                     YGAWLATRHLIQQGHTRIGYLCSNHSISDAEDRLQGYYDALAESGIAANDRLVTFGEPD
                     ESGGEQAMTELLGRGRNFTAVACYNDSMAAGAMGVLNDNGIDVPGEISLIGFDDVLVSR
                     YVRPRLTTVRYPIVTMATQAAELALALADNRPLPEITNVFSPTLVRRHSVSTPSLEASH
                     HATSD"
     protein_bind    1752..1773
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      1964..2508
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     promoter        3034..3136
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     CDS             3137..3793
                     /label=CmR
                     /note="chloramphenicol acetyltransferase"