Basic Vector Information
- Vector Name:
- pEF1a-tTA-Advanced-TRE-miR-30a loop-Neo
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6375 bp
- Type:
- Transcriptional regulation
- Replication origin:
- ori
- Host:
- Mammalian cells
- Selection Marker:
- Neo/G418
- Promoter:
- EF-1α
- Growth Temperature:
- 37℃
pEF1a-tTA-Advanced-TRE-miR-30a loop-Neo vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pEF1a-tTA-Advanced-TRE-miR-30a loop-Neo vector Sequence
LOCUS 62056_8895 6375 bp DNA circular SYN 01-JAN-1980 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6375) AUTHORS . TITLE Direct Submission FEATURES Location/Qualifiers source 1..6375 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 123..1301 /label=EF-1-alpha promoter /note="strong constitutive promoter for human elongation factor EF-1-alpha" CDS 1330..2073 /codon_start=1 /label=tTA-Advanced /note="improved tetracycline-controlled transactivator" /translation="MSRLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHV KNKRALLDALAIEMLDRHHTHFCPLEGESWQDFLRNNAKSFRCALLSHRDGAKVHLGTR PTEKQYETLENQLAFLCQQGFSLENALYALSAVGHFTLGCVLEDQEHQVAKEERETPTT DSMPPLLRQAIELFDHQGAEPAFLFGLELIICGLEKQLKCESGGPADALDDFDLDMLPA DALDDFDLDMLPADALDDFDLDMLPG" polyA_signal 2130..2354 /label=bGH poly(A) signal /note="bovine growth hormone polyadenylation signal" promoter 2406..2720 /label=tight TRE promoter /note="Tet-responsive promoter PTight, consisting of seven tet operator sequences followed by the minimal CMV promoter" polyA_signal 3216..3337 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(3344..3799) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 3826..3930 /label=AmpR promoter promoter 3932..4289 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 4324..5115 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" polyA_signal 5350..5397 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 5726..6314 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.