Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V014631 | pDC316-mNeonGreen-T2A | In stock, 1 week for quality controls |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
- Vector Name:
- pDC316-mNeonGreen-T2A
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4681 bp
- Type:
- Gene expression
- Replication origin:
- ori
- Host:
- Mammalian cells, Adenovirus
- Promoter:
- mCMV
- Growth Strain(s):
- Stbl3
- Growth Temperature:
- 37℃
pDC316-mNeonGreen-T2A vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pDC316-mNeonGreen-T2A vector Sequence
LOCUS 62056_8280 4681 bp DNA circular SYN 01-JAN-1980 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4681) AUTHORS . TITLE Direct Submission FEATURES Location/Qualifiers source 1..4681 /mol_type="other DNA" /organism="synthetic DNA construct" misc_signal 190..340 /label=Ad5 Psi /note="packaging signal for adenovirus serotype 5" promoter 462..990 /label=mCMV promoter /note="mouse cytomegalovirus (CMV) immediate early promoter" CDS 1005..1712 /codon_start=1 /label=mNeonGreen /note="bright monomeric yellow-green fluorescent protein derived from LanYFP (Shaner et al., 2013)" /translation="MVSKGEEDNMASLPATHELHIFGSINGVDFDMVGQGTGNPNDGYE ELNLKSTKGDLQFSPWILVPHIGYGFHQYLPYPDGMSPFQAAMVDGSGYQVHRTMQFED GASLTVNYRYTYEGSHIKGEAQVKGTGFPADGPVMTNSLTAADWCRSKKTYPNDKTIIS TFKWSYTTGNGKRYRSTARTTYTFAKPMAANYLKNQPMYVFRKTELKHSKTELNFKEWQ KAFTDVMGMDELYK" CDS 1713..1766 /codon_start=1 /label=T2A /note="2A peptide from Thosea asigna virus capsid protein" /translation="EGRGSLLTCGDVEENPGP" polyA_signal 1804..1938 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" protein_bind complement(1958..1991) /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." primer_bind complement(2013..2029) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(2037..2053) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2061..2091) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(2106..2127) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(2415..3003) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3177..4034) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" promoter complement(4035..4139) /label=AmpR promoter repeat_region 4681 /label=ITR /note="inverted terminal repeat of human adenovirus serotype 5"