Basic Vector Information
- Vector Name:
- pKR147
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4320 bp
- Type:
- Mammalian expression vector
- Replication origin:
- ori
- Source/Author:
- Rossger K, Charpin-El Hamri G, Fussenegger M.
pKR147 vector Vector Map
pKR147 vector Sequence
LOCUS 40924_26974 4320 bp DNA circular SYN 18-DEC-2018 DEFINITION Mammalian expression vector pKR147, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4320) AUTHORS Rossger K, Charpin-El Hamri G, Fussenegger M. TITLE Reward-based hypertension control by a synthetic brain-dopamine interface JOURNAL Proc. Natl. Acad. Sci. U.S.A. 110 (45), 18150-18155 (2013) PUBMED 24127594 REFERENCE 2 (bases 1 to 4320) AUTHORS Roessger K, Fussenegger M, Charpin-El-Hamri G. TITLE Direct Submission JOURNAL Submitted (09-AUG-2013) BSSE, ETH Zurich, Mattenstrasse 26, Basel, BS 4058, Switzerland REFERENCE 3 (bases 1 to 4320) TITLE Direct Submission REFERENCE 4 (bases 1 to 4320) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Proc. Natl. Acad. Sci. U.S.A."; date: "2013"; volume: "110"; issue: "45"; pages: "18150-18155" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (09-AUG-2013) BSSE, ETH Zurich, Mattenstrasse 26, Basel, BS 4058, Switzerland" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4320 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 23..976 /codon_start=1 /product="ANP-IgG" /label=ANP-IgG /note="extendin-4-furin cleavage site-ANP-linker-mIgG-Fc" /protein_id="AHA35650.1" /translation="MKIILWLCVFGLFLATLFPISWQMPVESGLSSEDSASSESFAKRI KRSLRRSSCFGGRIDRIGAQSGLGCNSFRYRRGSGGSGGSGGSGGSGGRSGCKPCICTV PEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPRE EQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIP PPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLN VQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK" polyA_signal complement(1016..1137) /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(1556..2144) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(2318..3175) /label=AmpR /note="beta-lactamase" promoter complement(3176..3280) /label=AmpR promoter rep_origin 3307..3762 /direction=RIGHT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" polyA_signal 3893..3941 /label=poly(A) signal /note="synthetic polyadenylation signal" misc_feature 3955..4046 /label=pause site /note="RNA polymerase II transcriptional pause signal from the human alpha-2 globin gene" regulatory 4080..4319 /label=CRE promoter /note="CRE promoter" /regulatory_class="promoter"
This page is informational only.