Basic Vector Information
- Vector Name:
- pKNG101
- Length:
- 6986 bp
- Type:
- Suicide vector
- Replication origin:
- R6K γ ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
- Promoter:
- sacB
pKNG101 vector Map
pKNG101 vector Sequence
LOCUS 40924_26919 6986 bp DNA circular SYN 18-DEC-2018 DEFINITION Suicide vector pKNG101, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6986) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 6986) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 6986) TITLE Direct Submission REFERENCE 4 (bases 1 to 6986) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6986 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 456..484 /label=tet promoter /note="E. coli promoter for tetracycline efflux protein gene" CDS 696..1499 /codon_start=1 /note="unnamed protein product; StrA; streptomycin resistance" /protein_id="SJL87110.1" /translation="MNRTNIFFGESHSDWLPVRGGESGDFVFRRGDGHAFAKIAPASRR GELAGERDRLIWLKGRGVACPEVINWQEEQEGACLVITAIPGVPAADLSGADLLKAWPS MGQQLGAVHSLSVDQCPFERRLSRMFGRAVDVVSRNAVNPDFLPDEDKSTPLHDLLARV ERELPVRLDQERTDMVVCHGDPCMPNFMVDPKTLQCTGLIDLGRLGTADRYADLALMIA NAEENWAAPDEAERAFAVLFNVLGIEAPDRERLAFYLRLDPLTWG" CDS 1499..2335 /codon_start=1 /note="unnamed protein product; StrB; streptomycin resistance" /protein_id="SJL87111.1" /translation="MFMPPVFPAHWHVSQPVLIADTFSSLVWKVSLPDGTPAIVKGLKP IEDIADELRGADYLVWRNGRGAVRLLGRENNLMLLEYAGERMLSHIVAEHGDYQATEIA AELMAKLYAASEEPLPSALLPIRDRFAALFQRARDDQNAGCQTDYVHAAIIADQMMSNA SELRGLHGDLHHENIMFSSRGWLVIDPVGLVGEVGFGAANMFYDPADRDDLCLDPRRIA QMADAFSRALDVDPRRLLDQAYAYGCLSAAWNADGEEEQRDLAIAAAIKQVRQTSY" rep_origin 2371..2759 /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" oriT 3479..3588 /label=oriT /note="incP origin of transfer" CDS 4001..4504 /codon_start=1 /note="unnamed protein product; insB" /protein_id="SJL87112.1" /translation="MPGNSPHYGRWPQHDFTSLKKLRPQSVTSRIQPGSDVIVCAEMDE QWGYVGAKSRQRWLFYAYDSLRKTVVAHVFGERTMATLGRLMSLLSPFDVVIWMTDGWP LYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNI KHYQ" CDS complement(4645..6063) /label=SacB /note="secreted levansucrase that renders bacterial growth sensitive to sucrose" promoter complement(6064..6509) /label=sacB promoter /note="sacB promoter and control region" misc_feature 6570..6969 /label=cos /note="lambda cos site; allows packaging into phage lambda particles"
This page is informational only.