pKLAC1-Gluc vector (V005218)

Download GeneBank File(.gb)

LOCUS       40924_26844        9589 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Expression vector pKLAC1-Gluc, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 9589)
  AUTHORS   Colussi PA, Ganatra MB, Read JD, Taron CH.
  TITLE     A vector for expression of Gaussia princeps luciferase tagged 
            proteins in the yeast Kluyveromyces lactis
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 9589)
  AUTHORS   Colussi PA, Ganatra MB, Read JD, Taron CH.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-AUG-2008) Gene Expression Division, New England 
            Biolabs, 240 County Road, Ipswich, MA 01938, USA
REFERENCE   3  (bases 1 to 9589)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 9589)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (12-AUG-2008) Gene Expression Division, New England Biolabs, 240 
            County Road, Ipswich, MA 01938, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..9589
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    14..331
                     /note="Kluyveromyces lactis alpha mating factor pre-pro 
                     secretion leader"
     misc_feature    290..331
                     /label=multiple cloning site
                     /note="multiple cloning site"
     CDS             332..838
                     /codon_start=1
                     /gene="Gluc"
                     /product="luciferase"
                     /label=Gluc
                     /note="derived from Gaussia princeps"
                     /protein_id="ACI46139.1"
                     /translation="KPTENNEDFNIVAVASNFATTDLDADRGKLPGKKLPLEVLKEMEA
                     NARKAGCTRGCLICLSHIKCTPKMKKFIPGRCHTYEGDKESAQGGIGEAIVDIPEIPGF
                     KDLEPMEQFIAQVDLCVDCTTGCLKGLANVQCSDLLKKWLPQRCATFASKIQGQVDKIK
                     GAGGD"
     gene            332..838
                     /gene="Gluc"
                     /label=Gluc
     terminator      853..1471
                     /label=LAC4 terminator
                     /note="transcription terminator for Kluyveromyces lactis
                     LAC4"
     promoter        1472..2174
                     /label=ADH1 promoter
                     /note="promoter for alcohol dehydrogenase 1"
     CDS             2195..3838
                     /label=amdS
                     /note="acetamidase from Aspergillus nidulans"
     promoter        4477..5133
                     /label=LAC4 promoter (5')
                     /note="5' portion of the Kluyveromyces lactis LAC4
                     promoter"
     promoter        complement(5150..5168)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(5182..5198)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(5206..5222)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(5230..5260)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(5275..5296)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(5584..6172)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(6346..7203)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(7204..7308)
                     /label=AmpR promoter
     rep_origin      7335..7790
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     primer_bind     7931..7947
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        7961..9489
                     /label=LAC4 promoter (3')
                     /note="3' portion of a modified Kluyveromyces lactis LAC4 
                     promoter"
     protein_bind    9495..9511
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."