Basic Vector Information
- Vector Name:
- pKKma
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6879 bp
- Type:
- Mariner transposon vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Zhang C.
- Promoter:
- Pc
pKKma vector Map
pKKma vector Sequence
LOCUS 40924_26834 6879 bp DNA circular SYN 18-DEC-2018 DEFINITION Mariner transposon vector pKKma, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6879) AUTHORS Zhang C. TITLE Characterization of a mariner transposon pKKma JOURNAL Unpublished REFERENCE 2 (bases 1 to 6879) AUTHORS Zhang C. TITLE Direct Submission JOURNAL Submitted (04-JUN-2014) Biological Engineering, Tianjin University of Science and Technology, Thirteen Avenue of Economic Development, Tianjin 300457, China REFERENCE 3 (bases 1 to 6879) TITLE Direct Submission REFERENCE 4 (bases 1 to 6879) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (04-JUN-2014) Biological Engineering, Tianjin University of Science and Technology, Thirteen Avenue of Economic Development, Tianjin 300457, China" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..6879 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(91..479) /direction=LEFT /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" CDS complement(415..1041) /codon_start=1 /gene="traI" /product="conjugal transfer relaxase" /label=traI /protein_id="AIN44219.1" /translation="MRSIKKSDFAELVKYITDEQGKTERLGHVRVTNCEANTLPAVMAE VMATQHGNTRSEADKTYHLLVSFRAGEKPDAETLRAIEDRICAGLGFAEHQRVSAVHHD TDNLHIHIAINKIHPTRNTIHEPYRAYRALADLCATLERDYGLERDNHETRQRVSENRA NDMERHAGVESLVGWIRPRCVRRRGSEDQQFNLLIVRTKLSCFTY" gene complement(415..1041) /gene="traI" /label=traI CDS complement(1100..1468) /label=traJ /note="oriT-recognizing protein" oriT complement(1501..1610) /direction=LEFT /label=oriT /note="incP origin of transfer" misc_feature 1836..2231 /note="similar to TraK; oriT binding protein" primer_bind complement(2229..2245) /label=SK primer /note="common sequencing primer, one of multiple similar variants" promoter 2276..2380 /label=AmpR promoter CDS 2381..3238 /label=AmpR /note="beta-lactamase" CDS 3567..4613 /codon_start=1 /gene="tnpA" /product="transposae" /label=tnpA /protein_id="AIN44221.1" /translation="MEKKEFRVLIKYCFLKGKNTVEAKTWLDNEFPDSAPGKSTIIDWY AKFKRGEMSTEDGERSGRPKEVVTDENIKKIHKMILNDRKMKLIEIAEALKISKERVGH IIHQYLDMRKLCAKWVPRELTFDQKQRRVDDSKRCLQLLTRNTPEFFRRYVTMDETWLH HYTPESNRQSAEWTATGEPSPKRGKTQKSAGKVMASVFWDAHGIIFIDYLEKGKTINSD YYMALLERLKVEIAAKRPHMKKKKVLFHQDNAPCHKSLRTMAKIHELGFELLPHPPYSP DLAPSDFFLFSDLKRMLAGKKFGCNEEVIAETEAYFEAKPKEYYQNGIKKLEGRYNRCI ALEGNYVE" gene 3567..4613 /gene="tnpA" /label=tnpA promoter complement(4675..4693) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(4703..4719) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" repeat_region 4851..4877 CDS complement(5056..5586) /label=GmR /note="gentamycin acetyltransferase" promoter complement(5775..5803) /label=Pc promoter /note="class 1 integron promoter" promoter 6504..6532 /label=tac promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 6540..6556 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." repeat_region 6612..6638
This page is informational only.