Basic Vector Information
- Vector Name:
- pKK388-1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5075 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Kitts PA.
- Promoter:
- lac UV5
pKK388-1 vector Map
pKK388-1 vector Sequence
LOCUS 40924_26824 5075 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pKK388-1, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5075) AUTHORS Kitts PA. TITLE CLONTECH Vectors On Disc version 1.3 JOURNAL Unpublished REFERENCE 2 (bases 1 to 5075) AUTHORS Brosius J. TITLE Expression vectors employing lambda-, trp-, lac- and lpp-derived promoters JOURNAL (in) Rodriguez,R.L. and Denhardt,D.T. (Eds.); VECTORS: 205-225; (1988) REFERENCE 3 (bases 1 to 5075) AUTHORS Kitts PA. TITLE Direct Submission JOURNAL Submitted (07-OCT-1993) Paul A. Kitts, CLONTECH Laboratories, Inc., 1020 East Meadow Circle, Palo Alto, CA 94303, USA REFERENCE 4 (bases 1 to 5075) TITLE Direct Submission REFERENCE 5 (bases 1 to 5075) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "(in) Rodriguez,R.L. and Denhardt,D.T. (Eds.)"; volume: " VECTORS"; pages: " 205-225; (1988" COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted (07-OCT-1993) Paul A. Kitts, CLONTECH Laboratories, Inc., 1020 East Meadow Circle, Palo Alto, CA 94303, USA" COMMENT SGRef: number: 4; type: "Journal Article" COMMENT This vector can be obtained from CLONTECH Laboratories, Inc., 1020 East Meadow Circle, Palo Alto, CA 94303, USA. To place an order call (415) 424-8222 or (800) 662-2566, extension 1. International customers, please contact your local distributor. For technical information, call (415) 424- 8222 or (800) 662-2566, extension 3. This sequence was compiled by Jurgen Brosius. If you suspect there is an error in this sequence, please contact CLONTECH's Technical Service Department at (415) 424-8222 or (800) 662-2566, extension 3 or E-mail TECH@CLONTECH.COM. FEATURES Location/Qualifiers source 1..5075 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 163..192 /label=trc promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 200..216 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." misc_feature 233..302 /label=rrnG antiterminator /note="antiterminator from the E. coli rrnG leader region (Berg et al., 1989)" RBS 316..324 /label=Shine-Dalgarno sequence /note="full consensus sequence for ribosome-binding sites upstream of start codons in E. coli; complementary to a region in the 3' end of the 16S rRNA (Chen et al., 1994)" misc_feature 341..397 /label=MCS /note="pUC18/19 multiple cloning site" terminator 600..686 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 778..805 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter 825..916 /label=AmpR promoter CDS 917..1774 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" rep_origin 1948..2536 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(2722..2862) /label=bom /note="basis of mobility region from pBR322" CDS complement(2967..3155) /codon_start=1 /label=rop /note="Rop protein, which maintains plasmids at low copy number" /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA DELYRSCLARFGDDGENL" CDS complement(3797..4984) /codon_start=1 /label=TcR /note="tetracycline efflux protein" /translation="MKSNNALIVILGTVTLDAVGIGLVMPVLPGLLRDIVHSDSIASHY GVLLALYALMQFLCAPVLGALSDRFGRRPVLLASLLGATIDYAIMATTPVLWILYAGRI VAGITGATGAVAGAYIADITDGEDRARHFGLMSACFGVGMVAGPVAGGLLGAISLHAPF LAAAVLNGLNLLLGCFLMQESHKGERRPMPLRAFNPVSSFRWARGMTIVAALMTVFFIM QLVGQVPAALWVIFGEDRFRWSATMIGLSLAVFGILHALAQAFVTGPATKRFGEKQAII AGMAADALGYVLLAFATRGWMAFPIMILLASGGIGMPALQAMLSRQVDDDHQGQLQGSL AALTSLTSITGPLIVTAIYAASASTWNGLAWIVGAALYLVCLPALRRGAWSRATST" promoter complement(5023..5053) /label=lac UV5 promoter /note="E. coli lac promoter with an 'up' mutation"
This page is informational only.