pKK233-2 vector (V005224)

Download GeneBank File(.gb)

LOCUS       40924_26814        4593 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pKK233-2, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4593)
  AUTHORS   Amann E, Brosius J.
  TITLE     'ATG vectors' for regulated high-level expression of cloned genes in
            Escherichia coli
  JOURNAL   Gene 40 (2-3), 183-190 (1985)
  PUBMED    3007288
REFERENCE   2  (bases 1 to 4593)
  AUTHORS   Kitts PA.
  TITLE     CLONTECH Vectors On Disc version 1.3
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 4593)
  AUTHORS   Kitts PA.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-OCT-1993) Paul A. Kitts, CLONTECH Laboratories, Inc., 
            1020 East Meadow Circle, Palo Alto, CA 94303, USA
REFERENCE   4  (bases 1 to 4593)
  TITLE     Direct Submission
REFERENCE   5  (bases 1 to 4593)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Gene 40 
            (2-3), 183-190 (1985)"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 3; type: "Journal Article"; journalName: "Submitted 
            (07-OCT-1993) Paul A. Kitts, CLONTECH Laboratories, Inc., 1020 East 
            Meadow Circle, Palo Alto, CA 94303, USA"
COMMENT     SGRef: number: 4; type: "Journal Article"
COMMENT     This vector can be obtained from CLONTECH Laboratories, Inc., 1020 
            East Meadow Circle, Palo Alto, CA 94303, USA. To place an order call
            (415) 424-8222 or (800) 662-2566, extension 1. International 
            customers, please contact your local distributor.  For technical 
            information, call (415) 424- 8222 or (800) 662-2566, extension 3. 
            This sequence was compiled by Jurgen Brosius. If you suspect there 
            is an error in this sequence, please contact CLONTECH's Technical 
            Service Department at (415) 424-8222 or (800) 662-2566, extension 3 
            or E-mail TECH@CLONTECH.COM.
FEATURES             Location/Qualifiers
     source          1..4593
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        204..233
                     /label=trc promoter
                     /note="strong E. coli promoter; hybrid between the trp and
                     lac UV5 promoters"
     protein_bind    241..257
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     terminator      498..584
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      676..703
                     /label=rrnB T2 terminator
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     promoter        723..814
                     /label=AmpR promoter
     CDS             815..1672
                     /codon_start=1
                     /label=AmpR
                     /note="beta-lactamase"
                     /translation="[TEM beta-lactamase fragment, 45 aa]
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     [TEM beta-lactamase fragment, 59 aa]
                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     [TEM beta-lactamase fragment, 59 aa]
                     LIKHW"
     rep_origin      1846..2434
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_feature    complement(2620..2760)
                     /label=bom
                     /note="basis of mobility region from pBR322"
     CDS             complement(2865..3053)
                     /codon_start=1
                     /label=rop
                     /note="Rop protein, which maintains plasmids at low copy
                     number"
                     /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA
                     DELYRSCLARFGDDGENL"