Basic Vector Information
- Vector Name:
- pKK22
- Length:
- 4841 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Krute CN, Krausz KL, Markiewicz MA, Joyner JA, Pokhrel S, Hall PR, Bose JL.
pKK22 vector Map
pKK22 vector Sequence
LOCUS V005225 4841 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V005225 VERSION V005225 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 4841) AUTHORS Krute CN, Krausz KL, Markiewicz MA, Joyner JA, Pokhrel S, Hall PR, Bose JL. TITLE Generation of a stable plasmid for in vitro and in vivo studies of Staphylococcus JOURNAL Appl. Environ. Microbiol. (2016) In press PUBMED 27637878 REFERENCE 2 (bases 1 to 4841) AUTHORS Krausz KL, Krute CN, Markiewicz MA, Bose JL. TITLE Direct Submission JOURNAL Submitted (15-APR-2016) Microbiology, Molecular Genetics and Immunology, University of Kansas Medical Center, 3901 Rainbow Blvd, Kansas City, KS 66160, USA REFERENCE 3 (bases 1 to 4841) TITLE Direct Submission REFERENCE 4 (bases 1 to 4841) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol. (2016) In press" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (15-APR-2016) Microbiology, Molecular Genetics and Immunology, University of Kansas Medical Center, 3901 Rainbow Blvd, Kansas City, KS 66160, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4841 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 1..996 /codon_start=1 /gene="repF" /product="RepF" /function="replication" /label="repF" /note="replication protein" /protein_id="AOR52293.1" /translation="MQYNTTRSITENQDNKTLKDMTKSGKQRPWREKKIDNVSYADILE ILKIKKAFNVKQCGNILEFKPTDEGYLKLHKTWFCKSKLCPVCNWRRAMKNSYQAQKVI EKVIKEKPKARWLFLTLSTKNAIDGDTLEQSLKHLTKAFDRLSRYKKVKQNLVGFMRST EVTVNKNDGSYNQHMHVLLCVENAYFRKKENYITQEEWVNLWQRALQVDYRPVANVKAI KPNRKGDKDIESAIKETSKYSVKSSDFLTDDDEKNQEIVSDLEKGLYRKRMLSYGGLLK QKHKILNLDDVEDGNLINASDEDKTTDEEEKAHSITAIWNFEKQNYYLRH" gene 1..996 /gene="repF" /label="repF" rep_origin 1179..1567 /label="R6K gamma ori" /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" regulatory 1580..1824 /label="sarA P1 promoter" /note="sarA P1 promoter" /regulatory_class="promoter" CDS 1847..2329 /gene="dfrA" /label="Dihydrofolate reductase type 1" /note="Dihydrofolate reductase type 1 from Tn4003 from Staphylococcus aureus. Accession#: P13955" regulatory 2340..2639 /label="blaZ transcriptional terminator" /note="blaZ transcriptional terminator" /regulatory_class="terminator" regulatory 2766..2823 /gene="atl" /regulatory_class="terminator" gene 2766..2823 /gene="atl" /label="atl" CDS 3064..3180 /codon_start=1 /gene="cds2" /product="hypothetical protein" /label="cds2" /protein_id="AOR52295.1" /translation="MGSVKKLVTGFAEIFVCEITIYLFGSYLRFKSLYIFLS" gene 3064..3180 /gene="cds2" /label="cds2" CDS 3262..3483 /codon_start=1 /gene="cds3" /product="hypothetical protein" /label="cds3" /protein_id="AOR52296.1" /translation="MIKFFKKGVFILNKNTVLDEGYVIATILNVFFLLGLIFISHLENL YILIPYVILMGINAIYLVVKVMNFKKNN" gene 3262..3483 /gene="cds3" /label="cds3" rep_origin 3631..3808 /label="sso" /note="sso" CDS complement(4029..4040) /label="WELQut site" /note="WELQut protease recognition and cleavage site" CDS 4465..4638 /codon_start=1 /gene="cds5" /product="hypothetical protein" /label="cds5" /protein_id="AOR52298.1" /translation="MNKFFYFLIILLSVFLIFNFVNSILFDNPFDFLESFIYSLVFTLI YLGLEGHKKKKE" gene 4465..4638 /gene="cds5" /label="cds5" rep_origin 4667..4687 /label="dso" /note="dso"
This page is informational only.