Basic Vector Information
- Vector Name:
- pKITE103P
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5787 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Toda H, Koyanagi T, Enomoto T, Itoh N.
pKITE103P vector Map
pKITE103P vector Sequence
LOCUS V005229 5787 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V005229 VERSION V005229 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 5787) AUTHORS Toda H, Koyanagi T, Enomoto T, Itoh N. TITLE Characterization of two cryptic plasmids from Kocuria palustris IPUFS-1 and construction of novel Escherichia coli-Kocuria shuttle vector for biocatalysis JOURNAL J. Biosci. Bioeng. 124 (3), 255-262 (2017) PUBMED 28495560 REFERENCE 2 (bases 1 to 5787) AUTHORS Itoh N, Toda H, Koyanagi T, Enomoto T. TITLE Direct Submission JOURNAL Submitted (12-DEC-2016) Contact:Nobuya Itoh Toyama Prefectural University, Biotechnology Research Center; 5180 Kurokawa, Imizu, Toyama 939-0398, Japan URL :http://www.pu-toyama.ac.jp/BR/itoh/ REFERENCE 3 (bases 1 to 5787) TITLE Direct Submission REFERENCE 4 (bases 1 to 5787) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J. Biosci. Bioeng."; date: "2017"; volume: "124"; issue: "3"; pages: "255-262" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (12-DEC-2016) Contact:Nobuya Itoh Toyama Prefectural University, Biotechnology Research Center"; volume: " 5180 Kurokawa, Imizu, Toyama 939-0398, Japan URL :http"; pages: "//www.pu-toyama.ac.jp/BR/itoh" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5787 /mol_type="other DNA" /organism="synthetic DNA construct" source 4175..5781 /plasmid="pKPAL1" /strain="IPUFS-1" /mol_type="other DNA" /db_xref="taxon:71999" /organism="Kocuria palustris" misc_feature 336..392 /label="MCS" /note="pUC18/19 multiple cloning site" primer_bind complement(396..412) /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" rep_origin 625..1080 /label="f1 ori" /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 1362..1466 /label="AmpR promoter" CDS 1467..2324 /label="AmpR" /note="beta-lactamase" rep_origin 2498..3086 /direction=RIGHT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS 3314..4120 /gene="tsnR" /label="23S rRNA (adenosine(1067)-2'-O)-methyltransferase" /note="23S rRNA (adenosine(1067)-2'-O)-methyltransferase from Streptomyces azureus. Accession#: P18644" CDS 4307..5182 /codon_start=1 /gene="repA" /product="replication protein" /label="repA" /protein_id="BAX51307.1" /translation="MTTAECVQRWDQMWLPLWPLASDDLHAGVYRQARGEAMHRRYIET NPRALSNLLVVDIDHEDAALRTMWNRQAWWPNAVVENPSNGHAHAVWALNEPITRTEYA RRKPLAFAAAVTEGLRRSVDGDTGYSGLLTKNPAHDDWDALWCNSDRLYDLDELAEHLT EGGYMPPVSWKRSKRRNSVGLGRNCSIFETARTWAYREIRNHWFDSAGLHDAISAHVHE LNAEFPEPLPASEARAIAASIHRWITTKSRMWADGPAVYEATFSTIQAARGRKRVERTK ALLEGWQPNG" gene 4307..5182 /gene="repA" /label="repA" CDS 5175..5483 /codon_start=1 /gene="repB" /product="replication protein" /label="repB" /protein_id="BAX51308.1" /translation="MGDRYDRKGSSISEMSRGTGLSPATIKRWTSRSRDEWLQQKADER EAIRAFHDDEGHSWPQTAKHFRLDVSTVKRRAYRAREERKQEIAEQLQPPLPFPTNS" gene 5175..5483 /gene="repB" /label="repB"
This page is informational only.