Basic Vector Information
- Vector Name:
- pKEK1140
- Antibiotic Resistance:
- Kanamycin
- Length:
- 8419 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Rodriguez SA, Yu JJ, Davis G, Arulanandam BP, Klose KE.
pKEK1140 vector Vector Map
pKEK1140 vector Sequence
LOCUS V005247 8419 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V005247 VERSION V005247 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 8419) AUTHORS Rodriguez SA, Yu JJ, Davis G, Arulanandam BP, Klose KE. TITLE Targeted inactivation of francisella tularensis genes by group II introns JOURNAL Appl. Environ. Microbiol. 74 (9), 2619-2626 (2008) PUBMED 18310413 REFERENCE 2 (bases 1 to 8419) AUTHORS Rodriguez SA, Petrosino JF, Klose KE. TITLE Direct Submission JOURNAL Submitted (18-FEB-2008) Biology, South Texas Center for Emerging Infectious Diseases, The University of Texas at San Antonio, One UTSA Circle, San Antonio, TX 78249, USA REFERENCE 3 (bases 1 to 8419) TITLE Direct Submission REFERENCE 4 (bases 1 to 8419) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2008"; volume: "74"; issue: "9"; pages: "2619-2626" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (18-FEB-2008) Biology, South Texas Center for Emerging Infectious Diseases, The University of Texas at San Antonio, One UTSA Circle, San Antonio, TX 78249, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8419 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 106..127 /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." promoter 142..172 /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind 180..195 /label="lac operator" /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 216..389 /label="lacZ-alpha" /note="LacZ-alpha fragment of beta-galactosidase" intron 770..1372 /note="Lactococcus lactis LtrB group II intron" RBS 1405..1427 /label="RBS" /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" CDS 1619..3415 /gene="ltrA" /label="Group II intron-encoded protein LtrA" /note="Group II intron-encoded protein LtrA from Lactococcus lactis subsp. cremoris (strain MG1363). Accession#: P0A3U1" terminator 3610..3696 /label="rrnB T1 terminator" /note="transcription terminator T1 from the E. coli rrnB gene" terminator 3788..3815 /label="rrnB T2 terminator" /note="transcription terminator T2 from the E. coli rrnB gene" rep_origin 4036..4581 /label="p15A ori" /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." misc_feature complement(4912..6807) /note="corresponds to region within Francisella tularensis subsp. novicida plasmid, pFNL10, which encodes origin of replication" CDS complement(5273..6292) /codon_start=1 /gene="repA" /product="temperature-sensitive RepA" /label="repA" /note="contains amino acid mutation, methionine to isoleucine M120I" /protein_id="ACA63832.1" /translation="MKEVKNVNAGKEIAMSNTLVAGKYSLTKEEQNLIFLVASMVKRED KEFHRYKISLSDLEKATGVKHNRVRLKQLMHSIMSKPVWLNKEQTKIANWFAYIEADPK SSALICEFHWSLMPHIIQLQEYFTKAERQLLFSFKSKYSSRLYLLLKSKLGEQAGYANI VDCVLYVDDMINDFDLPKSYSNRYSNFKNKFLLPALEEINQLSDIFVTYDDKDHHRKHG RKITNIKFTVSKVAETEEEFKQKLLDTKNKEDYIPIEASERLREVVLSDELDLDLYYVR SIFRHHHLHDIERVCDDTWRNWDNKKIKDRKRVFIANIKKLEKKPEENHKLPFGFEEV" gene complement(5273..6292) /gene="repA" /label="repA" regulatory 7163..7322 /note="region encodes promoter of FTN1451 of Francisella tularensis subsp. novicida" /regulatory_class="promoter" CDS 7326..8138 /label="KanR" /note="aminoglycoside phosphotransferase" regulatory 8181..8419 /note="region encodes groELp promoter of Francisella tularensis subsp. holarctica strain, LVS" /regulatory_class="promoter"
This page is informational only.