Basic Vector Information
- Vector Name:
- pKD227
- Antibiotic Resistance:
- Streptomycin
- Length:
- 5596 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Landry BP, Palanki R, Dyulgyarov N, Hartsough LA, Tabor JJ.
pKD227 vector Map
pKD227 vector Sequence
LOCUS 40924_26596 5596 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pKD227, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5596) AUTHORS Landry BP, Palanki R, Dyulgyarov N, Hartsough LA, Tabor JJ. TITLE Phosphatase activity tunes two-component system sensor detection threshold JOURNAL Nat Commun 9 (1), 1433 (2018) PUBMED 29650958 REFERENCE 2 (bases 1 to 5596) AUTHORS Landry BP. TITLE Direct Submission JOURNAL Submitted (29-OCT-2017) Bioengineering, Rice University, 6100 Main St, Houston, TX 77005, USA REFERENCE 3 (bases 1 to 5596) TITLE Direct Submission REFERENCE 4 (bases 1 to 5596) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat Commun"; date: "2018"; volume: "9"; issue: "1"; pages: "1433" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (29-OCT-2017) Bioengineering, Rice University, 6100 Main St, Houston, TX 77005, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5596 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory 1..148 /label=pKanR from E. coli tn5 /note="pKanR from E. coli tn5" /regulatory_class="promoter" CDS 149..937 /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)" terminator 952..1046 /label=lambda t0 terminator /note="transcription terminator from phage lambda" misc_feature 1048..1049 /label=GC>CA /note="GC>CA" rep_origin 1160..1705 /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." promoter 1878..1955 /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." CDS 1956..3035 /label=lacI /note="lac repressor" terminator 3044..3130 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" misc_feature complement(3144..3149) /label=AvrII Scar /note="AvrII Scar" misc_feature complement(3149..3196) /label=ColE1 Fragment /note="ColE1 Fragment" misc_feature 3258 /label=+1 /note="+1" promoter 3302..3330 /label=tac promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" misc_feature 3336 /label=+1 /note="+1" protein_bind 3338..3354 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." misc_feature 3364..3397 /label=sRBS (1096.98) /note="sRBS (1096.98)" CDS 3398..5413 /codon_start=1 /product="Sbal195_3859 (TtrS)" /label=Sbal195_3859 /protein_id="AWU50966.1" /translation="MFSSGMSLKWPLSIQGSIEPKMTPRIIFRMALRTKVFITLLACLF ASANVFAVEPQNQSAPSDVMDAEVVAPVATEEPGYQVVDVGVLAIRGYKATINRWQPLM GWLETQIPNSYFRLHPLSLDELAKGVETQGLDFVITNPGQSVLLARQYSLTWLATLRSP LNNGAAMQVGSALVVRADSPYQTLTDLKGRRLGIVSKNAFGGYLTLVYEAQLKGIDLPR FVGEIIPLGFPLDNLLYQLDDQKSGNDAAKDNRLDATVVPVCQLEQMQAEGLINIGHYR VLDNQTPVGFHCQVSTRLYPNWSMAKTNRASQSLAKSVTQALLALPEDHLAAKSSDSAG WTTAVSQLAIDQLLKDLDMHPLQTPWWQRAWQWVKLHQQWAWFILGILVLLNAYHFWLE YRFSRRGRELINTQRQLNENRALLEHAQRIAIAGELGASLSHELNQPLAAIGHYCHGAE VRLQRGTSPEELQSVLTLIQQEVTRADSIISRLRNLLKKRPVSKQALYLHELVNETVPL LAYEFEQHQINLAVNVSGEPYLQSLDEVGMQQLLLNLLKNAFDACVQRLELESSGTEQS GMRKPYVPTIDIDLRYQERTLLLTVTDNGTGLTEETSLLMQAFYSTKSEGLGLGLVICR DIAESHGGTFSLESAMGGGCQAQVAIPRKPEPNGVL" misc_feature 3503..3557 /label=TM /note="TM" regulatory 4490..4499 /note="vertebrate consensus sequence for strong initiation of translation (Kozak, 1987)" /regulatory_class="other" misc_feature 4532..4588 /label=TM /note="TM" misc_feature 4718..4720 /label=Catalytic His /note="Catalytic His" terminator complement(5434..5477) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" misc_feature 5503..5510 /label=BB Scar /note="BB Scar" terminator 5518..5545 /label=T7Te terminator /note="phage T7 early transcription terminator" misc_feature 5552..5596 /label=pUC19 MCS /note="pUC19 MCS"
This page is informational only.