pKD182 vector (V005251)

Download GeneBank File(.gb)

LOCUS       40924_26586        5364 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pKD182, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5364)
  AUTHORS   Landry BP, Palanki R, Dyulgyarov N, Hartsough LA, Tabor JJ.
  TITLE     Phosphatase activity tunes two-component system sensor detection 
            threshold
  JOURNAL   Nat Commun 9 (1), 1433 (2018)
  PUBMED    29650958
REFERENCE   2  (bases 1 to 5364)
  AUTHORS   Landry BP.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-OCT-2017) Bioengineering, Rice University, 6100 Main 
            St, Houston, TX 77005, USA
REFERENCE   3  (bases 1 to 5364)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 5364)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Nat 
            Commun"; date: "2018"; volume: "9"; issue: "1"; pages: "1433"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (29-OCT-2017) Bioengineering, Rice University, 6100 Main St, 
            Houston, TX 77005, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..5364
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      1..148
                     /label=PKanR from E. coli tn5
                     /note="PKanR from E. coli tn5"
                     /regulatory_class="promoter"
     CDS             149..937
                     /label=SmR
                     /note="aminoglycoside adenylyltransferase (Murphy, 1985)"
     terminator      952..1046
                     /label=lambda t0 terminator
                     /note="transcription terminator from phage lambda"
     rep_origin      1160..1705
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     promoter        1878..1955
                     /label=lacIq promoter
                     /note="In the lacIq allele, a single base change in the
                     promoter boosts expression of the lacI gene about 10-fold."
     CDS             1956..3035
                     /label=lacI
                     /note="lac repressor"
     terminator      3044..3130
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     misc_feature    complement(3144..3149)
                     /label=AvrII Scar
                     /note="AvrII Scar"
     misc_feature    complement(3149..3196)
                     /label=ColE1 Fragment
                     /note="ColE1 Fragment"
     misc_feature    3258
                     /label=+1
                     /note="+1"
     promoter        3302..3330
                     /label=tac promoter
                     /note="strong E. coli promoter; hybrid between the trp and
                     lac UV5 promoters"
     misc_feature    3336
                     /label=+1
                     /note="+1"
     protein_bind    3338..3354
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     misc_feature    3364..3396
                     /label=sRBS (1051.22)
                     /note="sRBS (1051.22)"
     CDS             3397..5181
                     /codon_start=1
                     /product="Shal_3128"
                     /label=Shal_3128
                     /protein_id="AWU50963.1"
                     /translation="MSRLLLCICVLLFSSVAWSKPQQFYVGVLANWGHQQAVERWTPMM
                     EYLNEHVPDAEFHVYPGNFKALNLAMELGQIQFIITNPGQYLYLSNQYPLSWLATMRSK
                     RHDGTTSAIGSAIIVRADSDYRTLYDLKGKVVAASDPHALGGYQATVGLMHSLGMDPDT
                     FFGETKFLGFPLDPLLYQVRDGNVDAAITPLCTLEDMVARGVLKSSDFRVLNPSRPDGV
                     ECQCSTTLYPNWSFAATESVSTELSKEITQALLELPSDSPAAIKAQLTGWTSPISQLAV
                     IKLFKELHVKTPDSSRWEAVKKWLEENRHWGILSVLVFIIATLYHLWIEYRFHQKSSSL
                     IESERQLKQQAVALERLQSASIVGEIGAGLAHEINQPIAAITSYSEGGIMRLQGKEQAD
                     TDSCIELLEKIHKQSTRAGEVVHRIRGLLKRREAVMVDVNILTLVEESISLLRLELARR
                     EIQINTQIKGEPFFITADRVGLLQVLINLIKNSLDAIAESDNARSGKINIELDFKEYQV
                     NVSIIDNGPGLAMDSDTLMATFYTTKMDGLGLGLAICREVISNHDGHFLLSNRDDGVLG
                     CVATLNLKKRGSEVPIEV"
     misc_feature    4237
                     /label=Mutation
                     /note="Mutation"
     misc_feature    4483..4539
                     /label=H-Box
                     /note="H-Box"
     misc_feature    4510..4512
                     /label=Catalytic His
                     /note="Catalytic His"
     misc_feature    4531..4536
                     /label=SDR
                     /note="SDR"
     misc_feature    4543..4548
                     /label=SDR
                     /note="SDR"
     misc_feature    4552..4557
                     /label=SDR
                     /note="SDR"
     misc_feature    4621..4623
                     /label=SDR
                     /note="SDR"
     misc_feature    4630..4635
                     /label=SDR
                     /note="SDR"
     misc_feature    4822..4881
                     /label=N-Box
                     /note="N-Box"
     misc_feature    4951..4980
                     /label=D-Box
                     /note="D-Box"
     misc_feature    complement(5006..5034)
                     /label=Priming Region
                     /note="Priming Region"
     misc_feature    5032..5145
                     /label=G-Box
                     /note="G-Box"
     misc_feature    5032..5046
                     /label=GxGxG Motif
                     /note="GxGxG Motif"
     misc_feature    5035..5037
                     /label=Mutantation Point
                     /note="Mutantation Point"
     misc_feature    5038..5058
                     /label=Priming Region
                     /note="Priming Region"
     terminator      complement(5202..5245)
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     misc_feature    5271..5278
                     /label=BB Scar
                     /note="BB Scar"
     terminator      5286..5313
                     /label=T7Te terminator
                     /note="phage T7 early transcription terminator"
     misc_feature    5320..5364
                     /label=pUC19 MCS
                     /note="pUC19 MCS"