Basic Vector Information
- Vector Name:
- pKC26-FB1.1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 12615 bp
- Type:
- Gal4/UAS cloning vector
- Replication origin:
- ori
- Source/Author:
- Hadjieconomou D, Rotkopf S, Alexandre C, Bell DM, Dickson BJ, Salecker I.
- Promoter:
- hsp70
pKC26-FB1.1 vector Map
pKC26-FB1.1 vector Sequence
LOCUS 40924_26576 12615 bp DNA circular SYN 18-DEC-2018
DEFINITION Gal4/UAS cloning vector pKC26-FB1.1, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 12615)
AUTHORS Hadjieconomou D, Rotkopf S, Alexandre C, Bell DM, Dickson BJ,
Salecker I.
TITLE Flybow: genetic multicolor cell labeling for neural circuit analysis
in Drosophila melanogaster
JOURNAL Nat. Methods (2011) In press
PUBMED 21297619
REFERENCE 2 (bases 1 to 12615)
AUTHORS Hadjieconomou D, Rotkopf S, Alexandre C, Dickson BJ, Salecker I.
TITLE Direct Submission
JOURNAL Submitted (24-JAN-2011) Division of Molecular Neurobiology, MRC
National Institute for Medical Research, The Ridgeway, London,
England NW7 1AA, UK
REFERENCE 3 (bases 1 to 12615)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 12615)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat.
Methods (2011) In press"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(24-JAN-2011) Division of Molecular Neurobiology, MRC National
Institute for Medical Research, The Ridgeway, London, England NW7
1AA, UK"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..12615
/mol_type="other DNA"
/organism="synthetic DNA construct"
misc_feature 6..866
/label=5' mini-white fragment
/note="5' mini-white fragment"
protein_bind 884..917
/label=attB
/note="minimal attB site for the phi-C31 integrase (Groth
et
al., 2000)"
primer_bind complement(935..951)
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 1425..1529
/label=AmpR promoter
CDS 1530..2387
/label=AmpR
/note="beta-lactamase"
rep_origin 2561..3149
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
protein_bind 3437..3458
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 3473..3503
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind 3511..3527
/label=lac operator
/bound_moiety="lac repressor encoded by lacI"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 3535..3551
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind 3598..3692
/label=5X UAS
/note="five tandem copies of the 'ScaI site' 17-mer
CGGAGTACTGTCCTCCG, an upstream activating sequence (UAS)
that efficiently binds yeast Gal4 (Webster et al., 1988;
Pfeiffer et al., 2010)"
protein_bind 3716..3810
/label=5X UAS
/bound_moiety="GAL4"
/note="five tandem copies of the ""ScaI site"" 17-mer
CGGAGTACTGTCCTCCG, an upstream activating sequence (UAS)
that efficiently binds yeast Gal4 (Webster et al., 1988;
Pfeiffer et al., 2010)"
promoter 3829..4067
/label=hsp70 promoter
/note="Drosophila melanogaster hsp70Bb promoter"
misc_feature 4081..4110
/label=altered multiple cloning site
/note="altered multiple cloning site"
misc_recomb 4111..4144
/label=mFRT71
/note="mFRT71"
misc_feature 4151..4816
/note="membrane anchor; Region: Cd8a"
CDS 4151..4816
/codon_start=1
/product="mouse lymphocyte antigen CD8 alpha chain"
/label=mCD8
/translation="MASPLTRFLSLNLLLLGESIILGSGEAKPQAPELRIFPKKMDAEL
GQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSA
MRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSP
VHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIYIWAPLAGICVALLLSLIITLICYHSR
"
CDS 4823..5539
/label=EGFP
/note="enhanced GFP"
intron 5625..5690
/label=small t intron
/note="SV40 (simian virus 40) small t antigen intron"
CDS 5820..5840
/label=SV40 NLS
/note="nuclear localization signal of SV40 (simian virus
40) large T antigen"
polyA_signal 6265..6399
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"
polyA_signal 6423..6849
/label=hsp70 poly(A)
/note="polyadenlyation signal from the Drosophila
melanogaster hsp70Ab gene"
regulatory complement(6424..6852)
/label=hsp70Ab polyA signal
/note="hsp70Ab polyA signal"
/regulatory_class="polyA_signal_sequence"
CDS complement(6862..7578)
/label=Citrine
/note="enhanced variant of YFP (Heikal et al., 2001)"
misc_feature complement(7591..7638)
/label=Region: Lyn kinase
/note="Region: Lyn kinase"
misc_recomb complement(7645..7678)
/label=mFRT71
/note="mFRT71"
misc_recomb 7691..7724
/label=mFRT71
/note="mFRT71"
CDS 7731..8396
/label=mCD8
/note="mouse lymphocyte antigen CD8 alpha chain"
CDS 8403..9110
/label=mCherry
/note="monomeric derivative of DsRed fluorescent protein
(Shaner et al., 2004)"
intron 9196..9261
/label=small t intron
/note="SV40 (simian virus 40) small t antigen intron"
CDS 9391..9411
/label=SV40 NLS
/note="nuclear localization signal of SV40 (simian virus
40) large T antigen"
polyA_signal 9836..9970
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"
polyA_signal complement(9978..10404)
/label=hsp70 poly(A)
/note="polyadenlyation signal from the Drosophila
melanogaster hsp70Ab gene"
misc_feature complement(10424..10468)
/label=Region: 1xV5 tag
/note="Region: 1xV5 tag"
CDS complement(10424..10465)
/codon_start=1
/product="epitope tag from simian virus 5"
/label=V5 tag
/translation="GKPIPNPLLGLDST"
CDS complement(10475..11191)
/label=mCerulean
/note="enhanced monomeric variant of CFP (Rizzo et al.,
2004)"
CDS complement(11198..11863)
/label=mCD8
/note="mouse lymphocyte antigen CD8 alpha chain"
misc_recomb 11870..11903
/label=mFRT71
/note="mFRT71"
intron 11993..12058
/label=small t intron
/note="SV40 (simian virus 40) small t antigen intron"
CDS 12188..12208
/label=SV40 NLS
/note="nuclear localization signal of SV40 (simian virus
40) large T antigen"
polyA_signal 12480..12614
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"
This page is informational only.