Basic Vector Information
- Vector Name:
- pKanCOs1
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5276 bp
- Type:
- Cloning vector
- Replication origin:
- pSC101 ori
- Source/Author:
- Oster CJ, Phillips GJ.
pKanCOs1 vector Vector Map
pKanCOs1 vector Sequence
LOCUS 40924_26541 5276 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pKanCOs1, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5276) AUTHORS Oster CJ, Phillips GJ. TITLE Vectors for ligation-independent construction of lacZ gene fusions and cloning of PCR products using a nicking endonuclease JOURNAL Plasmid 66 (3), 180-185 (2011) PUBMED 21854804 REFERENCE 2 (bases 1 to 5276) AUTHORS Oster C, Phillips GJ. TITLE Direct Submission JOURNAL Submitted (26-APR-2011) Veterinary Microbiology, Iowa State University, 1802 University Boulevard, Ames, IA 50010, USA REFERENCE 3 (bases 1 to 5276) TITLE Direct Submission REFERENCE 4 (bases 1 to 5276) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid"; date: "2011"; volume: "66"; issue: "3"; pages: "180-185" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (26-APR-2011) Veterinary Microbiology, Iowa State University, 1802 University Boulevard, Ames, IA 50010, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5276 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind complement(127..143) /label=SK primer /note="common sequencing primer, one of multiple similar variants" rep_origin 847..1069 /label=pSC101 ori /note="low-copy replication origin that requires the Rep101 protein" CDS 1117..2064 /codon_start=1 /label=Rep101 /note="RepA protein needed for replication with the pSC101 origin" /translation="MSELVVFKANELAISRYDLTEHETKLILCCVALLNPTIENPTRKE RTVSFTYNQYAQMMNISRENAYGVLAKATRELMTRTVEIRNPLVKGFKIFQWTNYAKFS SEKLELVFSEEILPYLFQLKKFIKYNLEHVKSFENKYSMRIYEWLLKELTQKKTHKANI EISLDEFKFMLMLENNYHEFKRLNQWVLKPISKDLNTYSNMKLVVDKRGRPTDTLIFQV ELDRQMDLVTELENNQIKMNGDKIPTTITSDSYLHNGLRKTLHDALTAKIQLTSFEAKF LSDMQSKYDLNGSFSWLTQKQRTTLENILAKYGRI" CDS complement(3317..4129) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin complement(4575..5030) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 5172..5188 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 5198..5216 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind 5242..5258 /label=KS primer /note="common sequencing primer, one of multiple similar variants"
This page is informational only.