Basic Vector Information
- Vector Name:
- pKanB
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4250 bp
- Type:
- Intracelluar expression vector
- Replication origin:
- ori
- Source/Author:
- Lin-Cereghino J, Hashimoto MD, Moy A, Castelo J, Orazem CC, Kuo P, Xiong S, Gandhi V, Hatae CT, Chan A, Lin-Cereghino GP.
- Promoter:
- AOX1
pKanB vector Map
pKanB vector Sequence
LOCUS 40924_26536 4250 bp DNA circular SYN 18-DEC-2018 DEFINITION Intracelluar expression vector pKanB, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4250) AUTHORS Lin-Cereghino J, Hashimoto MD, Moy A, Castelo J, Orazem CC, Kuo P, Xiong S, Gandhi V, Hatae CT, Chan A, Lin-Cereghino GP. TITLE Direct selection of Pichia pastoris expression strains using new G418 resistance vectors JOURNAL Yeast 25 (4), 293-299 (2008) PUBMED 18327886 REFERENCE 2 (bases 1 to 4250) AUTHORS Lin-Cereghino J, Lin-Cereghino G. TITLE Direct Submission JOURNAL Submitted (16-NOV-2007) Biological Sciences, University of the Pacific, 3601 Pacific Ave, Stockton, CA 95211, USA REFERENCE 3 (bases 1 to 4250) TITLE Direct Submission REFERENCE 4 (bases 1 to 4250) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Yeast"; date: "2008"; volume: "25"; issue: "4"; pages: "293-299" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (16-NOV-2007) Biological Sciences, University of the Pacific, 3601 Pacific Ave, Stockton, CA 95211, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4250 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 2..922 /label=AOX1 promoter /note="inducible promoter, regulated by methanol" misc_feature 921..953 /label=multiple cloning site /note="multiple cloning site" CDS 971..1000 /codon_start=1 /label=Myc /note="Myc (human c-Myc proto-oncogene) epitope tag" /translation="EQKLISEEDL" CDS 1016..1033 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" terminator 1113..1359 /label=AOX1 terminator /note="transcription terminator for AOX1" CDS 1918..2730 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" CDS 2752..2781 /codon_start=1 /label=Myc /note="Myc (human c-Myc proto-oncogene) epitope tag" /translation="EQKLISEEDL" CDS 2797..2814 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" terminator 2893..3139 /gene="Pichia pastoris AOX1" /label=AOX1 terminator /note="transcription terminator for AOX1" terminator 3260..3507 /label=CYC1 terminator /note="transcription terminator for CYC1" rep_origin complement(3582..4170) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.