Basic Vector Information
- Vector Name:
- pJTOOL-3
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 5344 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- van Aartsen JJ, Rajakumar K.
- Promoter:
- sacB
pJTOOL-3 vector Map
pJTOOL-3 vector Sequence
LOCUS 40924_26361 5344 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pJTOOL-3, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5344) AUTHORS van Aartsen JJ, Rajakumar K. TITLE An optimized method for suicide vector-based allelic exchange in Klebsiella pneumoniae JOURNAL J. Microbiol. Methods 86 (3), 313-319 (2011) PUBMED 21699924 REFERENCE 2 (bases 1 to 5344) AUTHORS van Aartsen J, Rajakumar K. TITLE pJTOOL vectors JOURNAL Unpublished REFERENCE 3 (bases 1 to 5344) AUTHORS van Aartsen J, Rajakumar K. TITLE Direct Submission JOURNAL Submitted (01-APR-2011) Department of Infection, Immunity and Inflammation, University of Leicester, United Kingdom, University Road, Leicester, Leicestershire LE1 9HN, United Kingdom REFERENCE 4 (bases 1 to 5344) TITLE Direct Submission REFERENCE 5 (bases 1 to 5344) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J. Microbiol. Methods"; date: "2011"; volume: "86"; issue: "3"; pages: "313-319" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted (01-APR-2011) Department of Infection, Immunity and Inflammation, University of Leicester, United Kingdom, University Road, Leicester, Leicestershire LE1 9HN, United Kingdom" COMMENT SGRef: number: 4; type: "Journal Article" FEATURES Location/Qualifiers source 1..5344 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(30..418) /direction=LEFT /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" CDS complement(1039..1407) /codon_start=1 /label=traJ /note="oriT-recognizing protein" /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAV GQGYKITGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEE KQDELGKVMMGVVRPRAEP" oriT complement(1440..1549) /direction=LEFT /label=oriT /note="incP origin of transfer" CDS complement(2518..3174) /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" CDS complement(3275..4693) /codon_start=1 /label=SacB /note="secreted levansucrase that renders bacterial growth sensitive to sucrose" /translation="MNIKKFAKQATVLTFTTALLAGGATQAFAKETNQKPYKETYGISH ITRHDMLQIPEQQKNEKYQVPEFDSSTIKNISSAKGLDVWDSWPLQNADGTVANYHGYH IVFALAGDPKNADDTSIYMFYQKVGETSIDSWKNAGRVFKDSDKFDANDSILKDQTQEW SGSATFTSDGKIRLFYTDFSGKHYGKQTLTTAQVNVSASDSSLNINGVEDYKSIFDGDG KTYQNVQQFIDEGNYSSGDNHTLRDPHYVEDKGHKYLVFEANTGTEDGYQGEESLFNKA YYGKSTSFFRQESQKLLQSDKKRTAELANGALGMIELNDDYTLKKVMKPLIASNTVTDE IERANVFKMNGKWYLFTDSRGSKMTIDGITSNDIYMLGYVSNSLTGPYKPLNKTGLVLK MDLDPNDVTFTYSHFAVPQAKGNNVVITSYMTNRGFYADKQSTFAPSFLLNIKGKKTSV VKDSILEQGQLTVNK" promoter complement(4694..5139) /label=sacB promoter /note="sacB promoter and control region" promoter 5159..5177 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" misc_feature 5186..5293 /label=MCS /note="pBluescript multiple cloning site" promoter complement(5306..5324) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" protein_bind complement(5323..5339) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)."
This page is informational only.