Basic Vector Information
- Vector Name:
- pJPVCS
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6771 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Schmelling N, Axmann IM, Dienst D.
- Promoter:
- lac UV5
pJPVCS vector Vector Map
pJPVCS vector Sequence
LOCUS V005291 6771 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V005291 VERSION V005291 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 6771) AUTHORS Schmelling N, Axmann IM, Dienst D. TITLE The photosynthetic bacteria Rhodobacter capsulatus and Synechocystis sp. PCC 6803 as prokaryotic platforms for biosynthesis of cyclic plant triterpenes JOURNAL Unpublished REFERENCE 2 (bases 1 to 6771) AUTHORS Schmelling N, Axmann IM, Dienst D. TITLE Direct Submission JOURNAL Submitted (11-OCT-2017) Department of Chemistry - Microbial Chemistry, Angstrom and Science for Life Laboratory, Lagerhyddsvagen 1, Uppsala 75120 Uppsala, Sweden REFERENCE 3 (bases 1 to 6771) TITLE Direct Submission REFERENCE 4 (bases 1 to 6771) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (11-OCT-2017) Department of Chemistry - Microbial Chemistry, Angstrom and Science for Life Laboratory, Lagerhyddsvagen 1, Uppsala 75120 Uppsala, Sweden" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6771 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 305..323 /label="T7 promoter" /note="promoter for bacteriophage T7 RNA polymerase" misc_feature 384..405 /label="BioBrick prefix" /note="BioBrick prefix for parts that do not start with 'ATG'" CDS complement(407..1519) /codon_start=1 /gene="merR" /product="MerR family transcriptional regulator" /label="merR" /note="cobalt-dependent transcriptional regulator from Synechocystis sp. PCC 6803; coaR" /protein_id="ATY93172.1" /translation="MKTNHLTIKELTDAVGGGVTPRMVRHYHTLGLLPPVQRSEGNYRL YTQQDVQRLQRVIALKQQGFQLSHIRQLLDSHSEESLDPTLMVQLQQQYQAVIQQITRL RQTASALEGLLGRDQSCQITQAEALAQLKQLDVDVQEGLGKLDQLWTNLDAETTTHPEA FQESLKHLLPDLSAYSEITIHLLHQLVLACGDVSLVNAVRLSQGAIASARDALKAGCPV VTDVPVVAAALDQTRLAHLGCTVKTLIDDPHITGLREAEQAFWHHDHWQQRLQQIPQGC VLAIGYAPSVLLTACKLIEQQHIQPALVIGMPIGFSHAPGAKRRLMTSPIPHITIQGSL GGGLLAAVTLNALVETLIAKPDCHCYLTCL" gene complement(407..1519) /gene="merR" /label="merR" regulatory 1520..1600 /note="promoter including 5' UTR of coaT from Synechocystis sp. PCC 6803 (Moscow wildtype)" /regulatory_class="promoter" CDS 1601..2317 /label="Venus" /note="yellow fluorescent protein (YFP) with fast and efficient maturation (Nagai et al., 2002)" terminator 2329..2400 /label="rrnB T1 terminator" /note="transcription terminator T1 from the E. coli rrnB gene" terminator 2416..2443 /label="T7Te terminator" /note="phage T7 early transcription terminator" CDS complement(2468..3169) /gene="rppA" /label="Response regulator RppA" /note="Response regulator RppA from Synechocystis sp. (strain PCC 6803 / Kazusa). Accession#: Q55933" CDS 3288..4004 /label="mCerulean" /note="enhanced monomeric variant of CFP (Rizzo et al., 2004)" terminator complement(4019..4062) /label="rrnB T1 terminator" /note="transcription terminator T1 from the E. coli rrnB gene" regulatory 4103..4130 /note="phage T7 early transcription terminator; T7Te terminator" /regulatory_class="terminator" terminator 4103..4130 /label="T7Te terminator" /note="phage T7 early transcription terminator" misc_feature 4137..4157 /label="BioBrick suffix" /note="universal suffix for all parts" promoter complement(4603..4633) /label="lac UV5 promoter" /note="E. coli lac promoter with an 'up' mutation" protein_bind complement(4648..4669) /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(4960..5548) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5722..6579) /label="AmpR" /note="beta-lactamase" promoter complement(6580..6684) /label="AmpR promoter"
This page is informational only.