Basic Vector Information
- Vector Name:
- pJM252
- Antibiotic Resistance:
- Tetracycline
- Length:
- 7075 bp
- Type:
- Integration expression vector
- Replication origin:
- ori
- Source/Author:
- Meisner J, Goldberg JB.
pJM252 vector Map
pJM252 vector Sequence
LOCUS 40924_26301 7075 bp DNA circular SYN 18-DEC-2018 DEFINITION Integration expression vector pJM252, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7075) AUTHORS Meisner J, Goldberg JB. TITLE Escherichia coli rhaSR-PrhaBAD inducible promoter system allows tightly controlled gene expression over a wide range in Pseudomonas aeruginosa JOURNAL Appl. Environ. Microbiol. (2016) In press PUBMED 27613678 REFERENCE 2 (bases 1 to 7075) AUTHORS Meisner J. TITLE Direct Submission JOURNAL Submitted (26-AUG-2016) Biochemistry, Emory University School of Medicine, 1510 Clifton Road NE, Rollins Research Center, room G223, Atlanta, GA 30322, USA REFERENCE 3 (bases 1 to 7075) TITLE Direct Submission REFERENCE 4 (bases 1 to 7075) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol. (2016) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (26-AUG-2016) Biochemistry, Emory University School of Medicine, 1510 Clifton Road NE, Rollins Research Center, room G223, Atlanta, GA 30322, USA" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..7075 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 827..845 /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" CDS complement(905..1984) /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" promoter complement(1985..2062) /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." promoter 2292..2320 /label=tac promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 2328..2344 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind complement(2397..2413) /label=KS primer /note="common sequencing primer, one of multiple similar variants" promoter complement(2439..2457) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" protein_bind complement(2631..2678) /label=FRT /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)." oriT complement(2885..2993) /direction=LEFT /label=oriT /note="incP origin of transfer" rep_origin complement(4418..5006) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5831..7018) /codon_start=1 /label=TcR /note="tetracycline efflux protein" /translation="MKSNNALIVILGTVTLDAVGIGLVMPVLPGLLRDIVHSDSIASHY GVLLALYALMQFLCAPVLGALSDRFGRRPVLLASLLGATIDYAIMATTPVLWILYAGRI VAGITGATGAVAGAYIADITDGEDRARHFGLMSACFGVGMVAGPVAGGLLGAISLHAPF LAAAVLNGLNLLLGCFLMQESHKGERRPMPLRAFNPVSSFRWARGMTIVAALMTVFFIM QLVGQVPAALWVIFGEDRFRWSATMIGLSLAVFGILHALAQAFVTGPATKRFGEKQAII AGMAADALGYVLLAFATRGWMAFPIMILLASGGIGMPALQAMLSRQVDDDHQGQLQGSL AALTSLTSITGPLIVTAIYAASASTWNGLAWIVGAALYLVCLPALRRGAWSRATST" promoter complement(join(7066..7075,1..19)) /label=tet promoter /note="E. coli promoter for tetracycline efflux protein gene"
This page is informational only.