Basic Vector Information
- Vector Name:
- pJM251
- Antibiotic Resistance:
- Tetracycline
- Length:
- 6797 bp
- Type:
- Integration expression vector
- Replication origin:
- ori
- Source/Author:
- Meisner J, Goldberg JB.
- Promoter:
- araBAD
pJM251 vector Map
pJM251 vector Sequence
LOCUS 40924_26296 6797 bp DNA circular SYN 18-DEC-2018 DEFINITION Integration expression vector pJM251, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6797) AUTHORS Meisner J, Goldberg JB. TITLE Escherichia coli rhaSR-PrhaBAD inducible promoter system allows tightly controlled gene expression over a wide range in Pseudomonas aeruginosa JOURNAL Appl. Environ. Microbiol. (2016) In press PUBMED 27613678 REFERENCE 2 (bases 1 to 6797) AUTHORS Meisner J. TITLE Direct Submission JOURNAL Submitted (29-AUG-2016) Biochemistry, Emory University School of Medicine, 1510 Clifton Road NE, Rollins Research Center, room G223, Atlanta, GA 30322, USA REFERENCE 3 (bases 1 to 6797) TITLE Direct Submission REFERENCE 4 (bases 1 to 6797) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol. (2016) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (29-AUG-2016) Biochemistry, Emory University School of Medicine, 1510 Clifton Road NE, Rollins Research Center, room G223, Atlanta, GA 30322, USA" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..6797 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 827..845 /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" CDS complement(878..1753) /codon_start=1 /label=araC /note="L-arabinose regulatory protein" /translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYW HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE EKVNDVAVKLS" promoter 1780..2064 /label=araBAD promoter /note="promoter of the L-arabinose operon of E. coli; the araC regulatory gene is transcribed in the opposite direction (Guzman et al., 1995)" primer_bind complement(2119..2135) /label=KS primer /note="common sequencing primer, one of multiple similar variants" promoter complement(2161..2179) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" protein_bind complement(2353..2400) /label=FRT /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)." oriT complement(2607..2715) /direction=LEFT /label=oriT /note="incP origin of transfer" rep_origin complement(4140..4728) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5553..6740) /codon_start=1 /label=TcR /note="tetracycline efflux protein" /translation="MKSNNALIVILGTVTLDAVGIGLVMPVLPGLLRDIVHSDSIASHY GVLLALYALMQFLCAPVLGALSDRFGRRPVLLASLLGATIDYAIMATTPVLWILYAGRI VAGITGATGAVAGAYIADITDGEDRARHFGLMSACFGVGMVAGPVAGGLLGAISLHAPF LAAAVLNGLNLLLGCFLMQESHKGERRPMPLRAFNPVSSFRWARGMTIVAALMTVFFIM QLVGQVPAALWVIFGEDRFRWSATMIGLSLAVFGILHALAQAFVTGPATKRFGEKQAII AGMAADALGYVLLAFATRGWMAFPIMILLASGGIGMPALQAMLSRQVDDDHQGQLQGSL AALTSLTSITGPLIVTAIYAASASTWNGLAWIVGAALYLVCLPALRRGAWSRATST" promoter complement(join(6788..6797,1..19)) /label=tet promoter /note="E. coli promoter for tetracycline efflux protein gene"
This page is informational only.